BLASTX nr result
ID: Rehmannia22_contig00023811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00023811 (451 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305356.1| PREDICTED: BTB/POZ domain-containing protein... 80 4e-13 emb|CBI30274.3| unnamed protein product [Vitis vinifera] 73 3e-11 ref|XP_002277002.1| PREDICTED: BTB/POZ domain-containing protein... 73 3e-11 gb|EOY08167.1| Ubiquitin-protein ligases, putative isoform 3 [Th... 68 1e-09 gb|EOY08166.1| BTB/POZ domain-containing protein FBL11, putative... 68 1e-09 gb|EOY08165.1| BTB/POZ domain-containing protein FBL11, putative... 68 1e-09 gb|EMJ04427.1| hypothetical protein PRUPE_ppa000908mg [Prunus pe... 65 7e-09 ref|XP_004494153.1| PREDICTED: BTB/POZ domain-containing protein... 64 2e-08 ref|XP_006430266.1| hypothetical protein CICLE_v10013912mg [Citr... 64 3e-08 ref|XP_006430265.1| hypothetical protein CICLE_v10013912mg [Citr... 64 3e-08 ref|XP_006481823.1| PREDICTED: BTB/POZ domain-containing protein... 62 8e-08 ref|XP_006481822.1| PREDICTED: BTB/POZ domain-containing protein... 62 8e-08 ref|XP_006338937.1| PREDICTED: BTB/POZ domain-containing protein... 62 1e-07 ref|XP_006338936.1| PREDICTED: BTB/POZ domain-containing protein... 62 1e-07 ref|XP_006577063.1| PREDICTED: BTB/POZ domain-containing protein... 61 1e-07 ref|XP_003625779.1| LRR and BTB/POZ domain-containing protein FB... 59 9e-07 gb|ESW34864.1| hypothetical protein PHAVU_001G1880001g [Phaseolu... 58 1e-06 ref|XP_004249559.1| PREDICTED: BTB/POZ domain-containing protein... 57 2e-06 gb|EXB37743.1| hypothetical protein L484_013781 [Morus notabilis] 56 6e-06 >ref|XP_004305356.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Fragaria vesca subsp. vesca] Length = 920 Score = 79.7 bits (195), Expect = 4e-13 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 288 RYFLS VKIARCK Q+ LD+ +EARR PVHKETLV+VWNS+ + RTVVKERL Sbjct: 867 RYFLSTVKIARCKSQRYGLDVQFVEARRRPVHKETLVVVWNSKTISRTVVKERL 920 >emb|CBI30274.3| unnamed protein product [Vitis vinifera] Length = 1010 Score = 73.2 bits (178), Expect = 3e-11 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 6/60 (10%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLEARR------NPVHKETLVLVWNSEKLVRTVVKERL 288 RY LSIVKIARCK +K TL+L L+A R PVHKETLVLVW+S+ L RTVVKER+ Sbjct: 951 RYSLSIVKIARCKFRKCTLELQILDATRRPVHMERPVHKETLVLVWSSKNLTRTVVKERI 1010 >ref|XP_002277002.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Vitis vinifera] Length = 980 Score = 73.2 bits (178), Expect = 3e-11 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 6/60 (10%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLEARR------NPVHKETLVLVWNSEKLVRTVVKERL 288 RY LSIVKIARCK +K TL+L L+A R PVHKETLVLVW+S+ L RTVVKER+ Sbjct: 921 RYSLSIVKIARCKFRKCTLELQILDATRRPVHMERPVHKETLVLVWSSKNLTRTVVKERI 980 >gb|EOY08167.1| Ubiquitin-protein ligases, putative isoform 3 [Theobroma cacao] Length = 654 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/54 (62%), Positives = 39/54 (72%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 288 RY L VKIARCK Q+ + + EA R PVH+ETLVLVWNS + RTVVKERL Sbjct: 601 RYCLRSVKIARCKSQRCNVGPYFAEAHRKPVHRETLVLVWNSRNVFRTVVKERL 654 >gb|EOY08166.1| BTB/POZ domain-containing protein FBL11, putative isoform 2 [Theobroma cacao] Length = 715 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/54 (62%), Positives = 39/54 (72%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 288 RY L VKIARCK Q+ + + EA R PVH+ETLVLVWNS + RTVVKERL Sbjct: 662 RYCLRSVKIARCKSQRCNVGPYFAEAHRKPVHRETLVLVWNSRNVFRTVVKERL 715 >gb|EOY08165.1| BTB/POZ domain-containing protein FBL11, putative isoform 1 [Theobroma cacao] Length = 935 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/54 (62%), Positives = 39/54 (72%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 288 RY L VKIARCK Q+ + + EA R PVH+ETLVLVWNS + RTVVKERL Sbjct: 882 RYCLRSVKIARCKSQRCNVGPYFAEAHRKPVHRETLVLVWNSRNVFRTVVKERL 935 >gb|EMJ04427.1| hypothetical protein PRUPE_ppa000908mg [Prunus persica] Length = 965 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 288 R+FLS +KIA+CKLQK RR VHKETLVLVWNS + RTVVKERL Sbjct: 912 RHFLSTLKIAKCKLQKGLKVSFVKAPRRRQVHKETLVLVWNSSTVTRTVVKERL 965 >ref|XP_004494153.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Cicer arietinum] Length = 981 Score = 63.9 bits (154), Expect = 2e-08 Identities = 35/56 (62%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLE--ARRNPVHKETLVLVWNSEKLVRTVVKERL 288 RYFLS +KIARCK Q+ +L +RR VH ETLVLVWNS+ L RTVVKERL Sbjct: 926 RYFLSTLKIARCKSQRCAFNLPVPPPGSRRRSVHLETLVLVWNSKNLTRTVVKERL 981 >ref|XP_006430266.1| hypothetical protein CICLE_v10013912mg [Citrus clementina] gi|557532323|gb|ESR43506.1| hypothetical protein CICLE_v10013912mg [Citrus clementina] Length = 171 Score = 63.5 bits (153), Expect = 3e-08 Identities = 37/56 (66%), Positives = 43/56 (76%), Gaps = 2/56 (3%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNL-EARR-NPVHKETLVLVWNSEKLVRTVVKERL 288 RY LS VKI +CK + L HNL EARR + VHKE+LVLVWNS+ L+RTVVKERL Sbjct: 117 RYSLSTVKITKCKSKNRNL-CHNLSEARRQSSVHKESLVLVWNSKNLIRTVVKERL 171 >ref|XP_006430265.1| hypothetical protein CICLE_v10013912mg [Citrus clementina] gi|557532322|gb|ESR43505.1| hypothetical protein CICLE_v10013912mg [Citrus clementina] Length = 148 Score = 63.5 bits (153), Expect = 3e-08 Identities = 37/56 (66%), Positives = 43/56 (76%), Gaps = 2/56 (3%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNL-EARR-NPVHKETLVLVWNSEKLVRTVVKERL 288 RY LS VKI +CK + L HNL EARR + VHKE+LVLVWNS+ L+RTVVKERL Sbjct: 94 RYSLSTVKITKCKSKNRNL-CHNLSEARRQSSVHKESLVLVWNSKNLIRTVVKERL 148 >ref|XP_006481823.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like isoform X2 [Citrus sinensis] Length = 943 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLEARR-NPVHKETLVLVWNSEKLVRTVVKERL 288 RY LS VKI +CK + L + EARR + VHKE+LVLVWNS+ L+RTVVKERL Sbjct: 889 RYSLSTVKITKCKSKNRNLCHNWSEARRQSSVHKESLVLVWNSKNLIRTVVKERL 943 >ref|XP_006481822.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like isoform X1 [Citrus sinensis] Length = 966 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLEARR-NPVHKETLVLVWNSEKLVRTVVKERL 288 RY LS VKI +CK + L + EARR + VHKE+LVLVWNS+ L+RTVVKERL Sbjct: 912 RYSLSTVKITKCKSKNRNLCHNWSEARRQSSVHKESLVLVWNSKNLIRTVVKERL 966 >ref|XP_006338937.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like isoform X2 [Solanum tuberosum] Length = 810 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/54 (59%), Positives = 36/54 (66%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 288 R FL IVKIARC L++ TL PVH ETL+L W+S KL RTVVKERL Sbjct: 757 RNFLHIVKIARCNLKRRTLGSTKSGTCTTPVHAETLILTWDSRKLSRTVVKERL 810 >ref|XP_006338936.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like isoform X1 [Solanum tuberosum] Length = 963 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/54 (59%), Positives = 36/54 (66%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 288 R FL IVKIARC L++ TL PVH ETL+L W+S KL RTVVKERL Sbjct: 910 RNFLHIVKIARCNLKRRTLGSTKSGTCTTPVHAETLILTWDSRKLSRTVVKERL 963 >ref|XP_006577063.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like isoform X1 [Glycine max] Length = 979 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/56 (58%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLE--ARRNPVHKETLVLVWNSEKLVRTVVKERL 288 +YFLS +KIARCK Q+ +L R VH ETLVLVWNS L+RTVVKERL Sbjct: 924 KYFLSTLKIARCKSQRCAFNLPAPAPGVHRRSVHVETLVLVWNSRDLIRTVVKERL 979 >ref|XP_003625779.1| LRR and BTB/POZ domain-containing protein FBL11 [Medicago truncatula] gi|355500794|gb|AES81997.1| LRR and BTB/POZ domain-containing protein FBL11 [Medicago truncatula] Length = 1039 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/56 (57%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLE--ARRNPVHKETLVLVWNSEKLVRTVVKERL 288 RY LS +KIA+CK Q+ ++ +RR VH ETLVLVWN E L RTVVKERL Sbjct: 984 RYSLSTLKIAKCKSQRCAFNVSVPPPGSRRRSVHVETLVLVWNCENLTRTVVKERL 1039 >gb|ESW34864.1| hypothetical protein PHAVU_001G1880001g [Phaseolus vulgaris] Length = 797 Score = 57.8 bits (138), Expect = 1e-06 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDL--HNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 288 RY LS + IARCK +K +L AR VH ETLVLVWN+ L+RTVVKERL Sbjct: 742 RYSLSTLNIARCKSKKCAFNLPASTSGARSRSVHIETLVLVWNNRDLIRTVVKERL 797 >ref|XP_004249559.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Solanum lycopersicum] Length = 810 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/54 (53%), Positives = 35/54 (64%) Frame = -3 Query: 449 RYFLSIVKIARCKLQKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 288 R FL I+KIARC L++ + PVH ETL+L W+S KL RTVVKERL Sbjct: 757 RNFLCILKIARCNLKRRSFGSTKSGTCTTPVHAETLILTWDSRKLSRTVVKERL 810 >gb|EXB37743.1| hypothetical protein L484_013781 [Morus notabilis] Length = 1047 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -3 Query: 440 LSIVKIARCKLQKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKER 291 L VK+ARCK ++ L L LE RR PVHKETLVL W + +++ V KER Sbjct: 931 LRAVKLARCKSRECGLTLPFLEPRRKPVHKETLVLEWTGKNVIKKVAKER 980