BLASTX nr result
ID: Rehmannia22_contig00023441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00023441 (382 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73162.1| hypothetical protein M569_01595 [Genlisea aurea] 59 9e-07 >gb|EPS73162.1| hypothetical protein M569_01595 [Genlisea aurea] Length = 253 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/68 (48%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Frame = +1 Query: 178 MPEARDRLSRKEDVLAT*SNRHRIFSRG-GGNDRSVNLVVFVLEDDADDGQATGTPFRWR 354 MPEARDRL R++ +A +R + SR G +V FVLED+ + Q+ TPFRWR Sbjct: 1 MPEARDRLPRQDHPVAAAYSRSQYGSRPVDGRIGRGTVVAFVLEDENEGMQSNTTPFRWR 60 Query: 355 STAMVGTP 378 TAMVG+P Sbjct: 61 GTAMVGSP 68