BLASTX nr result
ID: Rehmannia22_contig00023396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00023396 (421 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71144.1| hypothetical protein M569_03619, partial [Genlise... 57 3e-06 dbj|BAJ53223.1| JHL06P13.2 [Jatropha curcas] 56 4e-06 ref|XP_006465345.1| PREDICTED: uncharacterized protein LOC102627... 56 6e-06 ref|XP_006427263.1| hypothetical protein CICLE_v10026660mg [Citr... 56 6e-06 >gb|EPS71144.1| hypothetical protein M569_03619, partial [Genlisea aurea] Length = 127 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +2 Query: 5 NIRTSCSSTRYTRDRISLSFGDAYGNQV 88 +IRTSCSSTRYTRDRISL+FGDAYGNQ+ Sbjct: 20 SIRTSCSSTRYTRDRISLAFGDAYGNQI 47 >dbj|BAJ53223.1| JHL06P13.2 [Jatropha curcas] Length = 162 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 8 IRTSCSSTRYTRDRISLSFGDAYGNQVPIANI 103 I TSCSSTRYTRDRISLSFGDAYGNQV + + Sbjct: 51 ISTSCSSTRYTRDRISLSFGDAYGNQVYVPRL 82 >ref|XP_006465345.1| PREDICTED: uncharacterized protein LOC102627694 [Citrus sinensis] Length = 163 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +2 Query: 5 NIRTSCSSTRYTRDRISLSFGDAYGNQV 88 +IRTSCSSTRYTRD+ISL+FGDAYGNQV Sbjct: 48 DIRTSCSSTRYTRDQISLAFGDAYGNQV 75 >ref|XP_006427263.1| hypothetical protein CICLE_v10026660mg [Citrus clementina] gi|557529253|gb|ESR40503.1| hypothetical protein CICLE_v10026660mg [Citrus clementina] Length = 163 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +2 Query: 5 NIRTSCSSTRYTRDRISLSFGDAYGNQV 88 +IRTSCSSTRYTRD+ISL+FGDAYGNQV Sbjct: 48 DIRTSCSSTRYTRDQISLAFGDAYGNQV 75