BLASTX nr result
ID: Rehmannia22_contig00023268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00023268 (454 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY05912.1| Zinc knuckle family protein, putative isoform 3 [... 57 3e-06 gb|EOY05910.1| Zinc knuckle family protein, putative isoform 1 [... 57 3e-06 >gb|EOY05912.1| Zinc knuckle family protein, putative isoform 3 [Theobroma cacao] Length = 909 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -1 Query: 454 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 335 HDFLEDE+ AWW T SG KIPS +EL SK+ +R+ LGF Sbjct: 870 HDFLEDELMAWWSATTRSGGKIPSEEELTSKVKERRMLGF 909 >gb|EOY05910.1| Zinc knuckle family protein, putative isoform 1 [Theobroma cacao] gi|508714014|gb|EOY05911.1| Zinc knuckle family protein, putative isoform 1 [Theobroma cacao] Length = 1087 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -1 Query: 454 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 335 HDFLEDE+ AWW T SG KIPS +EL SK+ +R+ LGF Sbjct: 1048 HDFLEDELMAWWSATTRSGGKIPSEEELTSKVKERRMLGF 1087