BLASTX nr result
ID: Rehmannia22_contig00023011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00023011 (456 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67046.1| hypothetical protein M569_07730, partial [Genlise... 56 6e-06 >gb|EPS67046.1| hypothetical protein M569_07730, partial [Genlisea aurea] Length = 640 Score = 55.8 bits (133), Expect = 6e-06 Identities = 36/73 (49%), Positives = 42/73 (57%) Frame = +3 Query: 237 FPSLSLPFRRNITYLPRFPPKLRGHPILQISASITAKPSSELRXXXXXXXXXXXXLVALR 416 FPS S F +I LPRF +L P +SASI AKPSSE+R L ALR Sbjct: 6 FPSCS-KFLYSIRCLPRFSSRL---PYRHVSASIKAKPSSEVRKKKHSSSESDDKLAALR 61 Query: 417 ELFSRPNINIDAY 455 ELF R +IN+DAY Sbjct: 62 ELFLRSDINVDAY 74