BLASTX nr result
ID: Rehmannia22_contig00022956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00022956 (717 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC25199.1| putative protein phosphatase 2C 8 [Morus notabilis] 53 5e-07 >gb|EXC25199.1| putative protein phosphatase 2C 8 [Morus notabilis] Length = 155 Score = 53.1 bits (126), Expect(2) = 5e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 289 HGVRLATEYAQKHLHKHVLSAGLPIELVCL 200 HG RLA EYAQKHLH +VLSAGLP ELVCL Sbjct: 116 HGGRLAAEYAQKHLHANVLSAGLPRELVCL 145 Score = 27.3 bits (59), Expect(2) = 5e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 318 RCAHFAIYDG 289 RCAHFAIYDG Sbjct: 106 RCAHFAIYDG 115