BLASTX nr result
ID: Rehmannia22_contig00022769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00022769 (338 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525615.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_002525618.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_002525614.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_002525617.1| conserved hypothetical protein [Ricinus comm... 73 3e-11 ref|XP_006449203.1| hypothetical protein CICLE_v10017864mg [Citr... 72 6e-11 ref|XP_002517994.1| conserved hypothetical protein [Ricinus comm... 72 8e-11 ref|XP_006437900.1| hypothetical protein CICLE_v10033348mg [Citr... 70 3e-10 emb|CAN82208.1| hypothetical protein VITISV_000178 [Vitis vinifera] 69 5e-10 emb|CAN82205.1| hypothetical protein VITISV_000175 [Vitis vinifera] 69 6e-10 gb|EMJ18874.1| hypothetical protein PRUPE_ppa024427mg [Prunus pe... 69 8e-10 gb|EMJ17716.1| hypothetical protein PRUPE_ppa024242mg [Prunus pe... 69 8e-10 gb|EMJ17522.1| hypothetical protein PRUPE_ppa019903mg [Prunus pe... 69 8e-10 ref|XP_006432142.1| hypothetical protein CICLE_v10003665mg [Citr... 68 1e-09 emb|CAN74549.1| hypothetical protein VITISV_011099 [Vitis vinifera] 67 2e-09 ref|XP_002306850.1| hypothetical protein POPTR_0005s24570g [Popu... 67 2e-09 ref|XP_002309907.1| hypothetical protein POPTR_0007s04060g [Popu... 67 3e-09 ref|XP_006380331.1| hypothetical protein POPTR_0007s03000g [Popu... 66 4e-09 emb|CAN74548.1| hypothetical protein VITISV_011098 [Vitis vinifera] 66 5e-09 gb|ESW31248.1| hypothetical protein PHAVU_002G222400g [Phaseolus... 65 7e-09 emb|CAN82204.1| hypothetical protein VITISV_000174 [Vitis vinifera] 65 9e-09 >ref|XP_002525615.1| conserved hypothetical protein [Ricinus communis] gi|223535051|gb|EEF36733.1| conserved hypothetical protein [Ricinus communis] Length = 96 Score = 74.3 bits (181), Expect = 2e-11 Identities = 30/48 (62%), Positives = 43/48 (89%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V+GA+ G+TC+++A QF+L+L+ F+SINPNL+CDAIF+ QWLC DG+A Sbjct: 49 VYGAQDGDTCTSVATQFDLTLEFFSSINPNLNCDAIFVGQWLCADGTA 96 >ref|XP_002525618.1| conserved hypothetical protein [Ricinus communis] gi|223535054|gb|EEF36736.1| conserved hypothetical protein [Ricinus communis] Length = 104 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/48 (62%), Positives = 43/48 (89%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V+GA+ G+TC+++A QF+L+L+ F+SINPNL+CDAIF+ QWLC DG+A Sbjct: 57 VYGAQDGDTCTSLAAQFDLTLEFFSSINPNLNCDAIFVGQWLCTDGTA 104 >ref|XP_002525614.1| conserved hypothetical protein [Ricinus communis] gi|223535050|gb|EEF36732.1| conserved hypothetical protein [Ricinus communis] Length = 104 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/48 (62%), Positives = 43/48 (89%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V+GA+ G+TC+++A QF+L+L+ F+SINPNL+CDAIF+ QWLC DG+A Sbjct: 57 VYGAQDGDTCTSLAAQFDLTLEFFSSINPNLNCDAIFVGQWLCTDGTA 104 >ref|XP_002525617.1| conserved hypothetical protein [Ricinus communis] gi|223535053|gb|EEF36735.1| conserved hypothetical protein [Ricinus communis] Length = 96 Score = 73.2 bits (178), Expect = 3e-11 Identities = 30/47 (63%), Positives = 42/47 (89%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGS 141 V+GA+ G+TC++IA QF+L+L+ F+SINPNL+CDAIF+ QWLC DG+ Sbjct: 49 VYGAQDGDTCTSIATQFDLTLEFFSSINPNLNCDAIFVGQWLCTDGT 95 >ref|XP_006449203.1| hypothetical protein CICLE_v10017864mg [Citrus clementina] gi|557551814|gb|ESR62443.1| hypothetical protein CICLE_v10017864mg [Citrus clementina] Length = 91 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V+GA+ G+TCS +A++FNLS F +INPN++CDAIF+ QWLCV GSA Sbjct: 44 VYGAQEGDTCSVVAEEFNLSTDVFLAINPNINCDAIFVGQWLCVAGSA 91 >ref|XP_002517994.1| conserved hypothetical protein [Ricinus communis] gi|223542976|gb|EEF44512.1| conserved hypothetical protein [Ricinus communis] Length = 95 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/48 (58%), Positives = 42/48 (87%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V+GA+ G+TC+++A QFNL+L+ F+SINPNL+CD F+ QWLC++G+A Sbjct: 48 VYGAQDGDTCTSVANQFNLTLEFFSSINPNLNCDDFFVGQWLCINGTA 95 >ref|XP_006437900.1| hypothetical protein CICLE_v10033348mg [Citrus clementina] gi|557540096|gb|ESR51140.1| hypothetical protein CICLE_v10033348mg [Citrus clementina] Length = 92 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/48 (60%), Positives = 40/48 (83%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V+G + G+TC +A++FNLS + F++INPNL+CDAIF+ QWLCV GSA Sbjct: 45 VYGTQEGDTCFDVAKEFNLSTEFFSAINPNLNCDAIFVGQWLCVAGSA 92 >emb|CAN82208.1| hypothetical protein VITISV_000178 [Vitis vinifera] Length = 89 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/48 (62%), Positives = 39/48 (81%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V G ESG+TC IA++F LS + F SINPNL+CDA+F+ QW+CVDG+A Sbjct: 41 VVGVESGDTCLDIAEKFQLSTEFFDSINPNLNCDALFVGQWVCVDGTA 88 >emb|CAN82205.1| hypothetical protein VITISV_000175 [Vitis vinifera] Length = 89 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V G ESG+TCS I ++F L+ + F SINPNL+CDA+F+ QW+CVDG+A Sbjct: 41 VVGVESGDTCSDITEKFQLTTEFFDSINPNLNCDALFVGQWVCVDGTA 88 >gb|EMJ18874.1| hypothetical protein PRUPE_ppa024427mg [Prunus persica] Length = 98 Score = 68.6 bits (166), Expect = 8e-10 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V+GAE G+TC+++++ FNLSL F SINPN++CD F+ QWLC GSA Sbjct: 50 VYGAEEGDTCTSVSEMFNLSLDFFLSINPNINCDNFFVGQWLCTAGSA 97 >gb|EMJ17716.1| hypothetical protein PRUPE_ppa024242mg [Prunus persica] Length = 95 Score = 68.6 bits (166), Expect = 8e-10 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V+GAE G+TC+++++ FNLSL F SINPN++CD F+ QWLC GSA Sbjct: 48 VYGAEEGDTCTSVSEMFNLSLDFFLSINPNINCDNFFVGQWLCTAGSA 95 >gb|EMJ17522.1| hypothetical protein PRUPE_ppa019903mg [Prunus persica] Length = 96 Score = 68.6 bits (166), Expect = 8e-10 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V+GAE G+TC+++++ FNLSL F SINPN++CD F+ QWLC GSA Sbjct: 48 VYGAEEGDTCTSVSEMFNLSLDFFLSINPNINCDNFFVGQWLCTAGSA 95 >ref|XP_006432142.1| hypothetical protein CICLE_v10003665mg [Citrus clementina] gi|557534264|gb|ESR45382.1| hypothetical protein CICLE_v10003665mg [Citrus clementina] Length = 91 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/48 (58%), Positives = 39/48 (81%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V+GA+ G+TC ++Q+FNLS + F +INPN+ CDA+F+ QWLCV GSA Sbjct: 44 VYGAQEGDTCFDVSQKFNLSNELFLAINPNIDCDAVFVGQWLCVAGSA 91 >emb|CAN74549.1| hypothetical protein VITISV_011099 [Vitis vinifera] Length = 92 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V G ESG+TC IA +F L+ + F SINPNL+CDA+F+ QW+CVDG+A Sbjct: 44 VVGVESGDTCFDIADKFQLTTEFFDSINPNLNCDALFVGQWVCVDGTA 91 >ref|XP_002306850.1| hypothetical protein POPTR_0005s24570g [Populus trichocarpa] gi|222856299|gb|EEE93846.1| hypothetical protein POPTR_0005s24570g [Populus trichocarpa] Length = 94 Score = 67.0 bits (162), Expect = 2e-09 Identities = 25/48 (52%), Positives = 38/48 (79%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 VHG +G+TC+ + +QF+L+ DF +INPNL CD +F+ QWLCV+G++ Sbjct: 46 VHGVVTGDTCTAVEKQFDLTANDFKAINPNLDCDKLFVGQWLCVEGTS 93 >ref|XP_002309907.1| hypothetical protein POPTR_0007s04060g [Populus trichocarpa] gi|222852810|gb|EEE90357.1| hypothetical protein POPTR_0007s04060g [Populus trichocarpa] Length = 95 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGS 141 V GA SG+TC TIAQ FNL+ F +INPNL+C A+F+ QWLCV GS Sbjct: 48 VVGAASGDTCFTIAQSFNLTAASFDAINPNLNCTALFVGQWLCVAGS 94 >ref|XP_006380331.1| hypothetical protein POPTR_0007s03000g [Populus trichocarpa] gi|550334007|gb|ERP58128.1| hypothetical protein POPTR_0007s03000g [Populus trichocarpa] Length = 95 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGS 141 V G SG+TC TIAQ FNL+ F +INPN+SC+A+F+ QWLCV GS Sbjct: 48 VVGVASGDTCFTIAQSFNLTAASFDAINPNISCNALFVGQWLCVAGS 94 >emb|CAN74548.1| hypothetical protein VITISV_011098 [Vitis vinifera] Length = 89 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGS 141 V G ESG+TC IA +F L+ + F SINPNL+CDA+F+ QW+CVDG+ Sbjct: 41 VVGVESGDTCFDIADKFQLTTEFFDSINPNLNCDALFVGQWVCVDGT 87 >gb|ESW31248.1| hypothetical protein PHAVU_002G222400g [Phaseolus vulgaris] Length = 82 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDG 138 VHG E GETC++I Q FNL + F INPN++C+ IF+ QW+CVDG Sbjct: 35 VHGVEEGETCTSIFQGFNLQERHFLGINPNINCNFIFVGQWVCVDG 80 >emb|CAN82204.1| hypothetical protein VITISV_000174 [Vitis vinifera] Length = 91 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = +1 Query: 1 VHGAESGETCSTIAQQFNLSLQDFTSINPNLSCDAIFLRQWLCVDGSA 144 V G ESG+TC IA + L+ + F SINPNL+CDA+F+ QW+CVDG+A Sbjct: 43 VVGVESGDTCFDIADKLQLTTEFFDSINPNLNCDALFVGQWVCVDGTA 90