BLASTX nr result
ID: Rehmannia22_contig00022698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00022698 (359 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529076.1| histone deacetylase 1, 2 ,3, putative [Ricin... 89 6e-16 gb|AAS79608.1| putative histone deacetylase [Ipomoea trifida] 89 6e-16 ref|XP_002270071.2| PREDICTED: histone deacetylase 9-like [Vitis... 88 1e-15 gb|EXB53709.1| Histone deacetylase 9 [Morus notabilis] 87 2e-15 ref|XP_004300044.1| PREDICTED: histone deacetylase 9-like [Fraga... 87 2e-15 ref|XP_004172671.1| PREDICTED: histone deacetylase 9-like, parti... 87 2e-15 ref|XP_004145792.1| PREDICTED: histone deacetylase 9-like [Cucum... 87 2e-15 ref|XP_003606237.1| Histone deacetylase [Medicago truncatula] gi... 87 2e-15 emb|CBI17064.3| unnamed protein product [Vitis vinifera] 87 2e-15 ref|XP_002266492.1| PREDICTED: histone deacetylase 9 [Vitis vini... 87 2e-15 emb|CAN77816.1| hypothetical protein VITISV_020659 [Vitis vinifera] 87 2e-15 ref|XP_006471388.1| PREDICTED: histone deacetylase 9-like [Citru... 86 5e-15 ref|XP_006349095.1| PREDICTED: histone deacetylase 9-like [Solan... 86 5e-15 ref|XP_006424306.1| hypothetical protein CICLE_v10029823mg [Citr... 86 5e-15 gb|EPS60971.1| histone deacetylase, partial [Genlisea aurea] 86 5e-15 ref|XP_004251031.1| PREDICTED: histone deacetylase 9-like [Solan... 86 5e-15 ref|XP_002300554.1| histone deacetylase-related family protein [... 86 5e-15 ref|XP_006419115.1| hypothetical protein EUTSA_v10002540mg [Eutr... 86 7e-15 ref|XP_006279377.1| hypothetical protein CARUB_v10007995mg [Caps... 86 7e-15 ref|NP_190054.2| histone deacetylase 9 [Arabidopsis thaliana] gi... 86 7e-15 >ref|XP_002529076.1| histone deacetylase 1, 2 ,3, putative [Ricinus communis] gi|223531488|gb|EEF33320.1| histone deacetylase 1, 2 ,3, putative [Ricinus communis] Length = 429 Score = 89.0 bits (219), Expect = 6e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >gb|AAS79608.1| putative histone deacetylase [Ipomoea trifida] Length = 438 Score = 89.0 bits (219), Expect = 6e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_002270071.2| PREDICTED: histone deacetylase 9-like [Vitis vinifera] Length = 458 Score = 87.8 bits (216), Expect = 1e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 122 RMRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 +MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 28 KMRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 67 >gb|EXB53709.1| Histone deacetylase 9 [Morus notabilis] Length = 429 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_004300044.1| PREDICTED: histone deacetylase 9-like [Fragaria vesca subsp. vesca] Length = 430 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_004172671.1| PREDICTED: histone deacetylase 9-like, partial [Cucumis sativus] Length = 219 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_004145792.1| PREDICTED: histone deacetylase 9-like [Cucumis sativus] Length = 430 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_003606237.1| Histone deacetylase [Medicago truncatula] gi|355507292|gb|AES88434.1| Histone deacetylase [Medicago truncatula] Length = 430 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >emb|CBI17064.3| unnamed protein product [Vitis vinifera] Length = 430 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_002266492.1| PREDICTED: histone deacetylase 9 [Vitis vinifera] gi|297734674|emb|CBI16725.3| unnamed protein product [Vitis vinifera] Length = 430 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >emb|CAN77816.1| hypothetical protein VITISV_020659 [Vitis vinifera] Length = 430 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_006471388.1| PREDICTED: histone deacetylase 9-like [Citrus sinensis] Length = 429 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKD+ISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_006349095.1| PREDICTED: histone deacetylase 9-like [Solanum tuberosum] Length = 430 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKD+ISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_006424306.1| hypothetical protein CICLE_v10029823mg [Citrus clementina] gi|557526240|gb|ESR37546.1| hypothetical protein CICLE_v10029823mg [Citrus clementina] Length = 429 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKD+ISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >gb|EPS60971.1| histone deacetylase, partial [Genlisea aurea] Length = 323 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 M+SKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MKSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_004251031.1| PREDICTED: histone deacetylase 9-like [Solanum lycopersicum] Length = 430 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKD+ISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_002300554.1| histone deacetylase-related family protein [Populus trichocarpa] gi|222847812|gb|EEE85359.1| histone deacetylase-related family protein [Populus trichocarpa] Length = 429 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKDRI+YFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_006419115.1| hypothetical protein EUTSA_v10002540mg [Eutrema salsugineum] gi|557097043|gb|ESQ37551.1| hypothetical protein EUTSA_v10002540mg [Eutrema salsugineum] Length = 426 Score = 85.5 bits (210), Expect = 7e-15 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKD+ISYFYDGDVG+VYFGP+HPMKPHRLCMTHHL+L Sbjct: 1 MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLIL 39 >ref|XP_006279377.1| hypothetical protein CARUB_v10007995mg [Capsella rubella] gi|482548074|gb|EOA12275.1| hypothetical protein CARUB_v10007995mg [Capsella rubella] Length = 426 Score = 85.5 bits (210), Expect = 7e-15 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKD+ISYFYDGDVG+VYFGP+HPMKPHRLCMTHHL+L Sbjct: 1 MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLIL 39 >ref|NP_190054.2| histone deacetylase 9 [Arabidopsis thaliana] gi|75244587|sp|Q8H0W2.1|HDA9_ARATH RecName: Full=Histone deacetylase 9 gi|25082914|gb|AAN72014.1| putative protein [Arabidopsis thaliana] gi|30387509|gb|AAP31920.1| At3g44680 [Arabidopsis thaliana] gi|332644409|gb|AEE77930.1| histone deacetylase 9 [Arabidopsis thaliana] Length = 426 Score = 85.5 bits (210), Expect = 7e-15 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -1 Query: 119 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 3 MRSKD+ISYFYDGDVG+VYFGP+HPMKPHRLCMTHHL+L Sbjct: 1 MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLIL 39