BLASTX nr result
ID: Rehmannia22_contig00022565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00022565 (369 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB54050.1| hypothetical protein L484_001388 [Morus notabilis] 56 4e-06 >gb|EXB54050.1| hypothetical protein L484_001388 [Morus notabilis] Length = 117 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +2 Query: 71 GNMRIKIVXXXXXXXXXXXXXXNRQGKKVEDVLGEIQRNREN-NVSWKPCLDSIIESPEV 247 G +R+KIV N+ GK +EDVLGEI+R R VSWKP L+SI+E PEV Sbjct: 53 GKLRVKIVVTKEELEWLMVQLNNKGGKSLEDVLGEIERGRAKVEVSWKPSLESIMECPEV 112 Query: 248 PE 253 E Sbjct: 113 VE 114