BLASTX nr result
ID: Rehmannia22_contig00022468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00022468 (727 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522909.1| hydrolase, hydrolyzing O-glycosyl compounds,... 57 8e-06 >ref|XP_002522909.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] gi|223537894|gb|EEF39509.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] Length = 117 Score = 56.6 bits (135), Expect = 8e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 1 ASFAFNSYYQNIKHNGANCYFTAATILTGLDPSKS 105 ASFAFN+YYQ KH GA CYF+AA ++T LDPS S Sbjct: 75 ASFAFNNYYQKFKHKGATCYFSAAAMITDLDPSHS 109