BLASTX nr result
ID: Rehmannia22_contig00022414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00022414 (911 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71393.1| hypothetical protein M569_03373 [Genlisea aurea] 65 5e-08 ref|XP_002316854.1| hypothetical protein POPTR_0011s11040g [Popu... 62 4e-07 gb|EXB22357.1| hypothetical protein L484_004350 [Morus notabilis] 60 1e-06 ref|XP_006477760.1| PREDICTED: uncharacterized protein LOC102626... 58 6e-06 >gb|EPS71393.1| hypothetical protein M569_03373 [Genlisea aurea] Length = 60 Score = 64.7 bits (156), Expect = 5e-08 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = +1 Query: 136 IPLPAGEVVRTKLVRLLYFVGAGAVCAVGINKWKDIERKSMIQKQ 270 +P+P GE V KL+RLL+FVGAG + GINKWK++E+KS IQKQ Sbjct: 3 VPVPPGEEVAPKLIRLLWFVGAGVLSVAGINKWKELEKKSAIQKQ 47 >ref|XP_002316854.1| hypothetical protein POPTR_0011s11040g [Populus trichocarpa] gi|222859919|gb|EEE97466.1| hypothetical protein POPTR_0011s11040g [Populus trichocarpa] Length = 71 Score = 61.6 bits (148), Expect = 4e-07 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = +1 Query: 145 PAGEVVRTKLVRLLYFVGAGAVCAVGINKWKDIERKSMIQKQQQ 276 PAG K++RLLYFVGAG +C VGINKW++IERKS++++QQQ Sbjct: 10 PAGP----KVLRLLYFVGAGFICTVGINKWREIERKSILEQQQQ 49 >gb|EXB22357.1| hypothetical protein L484_004350 [Morus notabilis] Length = 58 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 145 PAGEVVRTKLVRLLYFVGAGAVCAVGINKWKDIERKSMIQKQQQ 276 PAG KLVRLLYFVGAG +C VGINKW+D +RKSM+ + Q Sbjct: 9 PAGP----KLVRLLYFVGAGFICVVGINKWRDFQRKSMLSQHDQ 48 >ref|XP_006477760.1| PREDICTED: uncharacterized protein LOC102626014 [Citrus sinensis] Length = 67 Score = 57.8 bits (138), Expect = 6e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +1 Query: 130 EMIPLPAGEVVRTKLVRLLYFVGAGAVCAVGINKWKDIERKSMIQKQQQ 276 EM PAG TK++R LYFVGAG +C INKW+++ERKS+ +KQQ+ Sbjct: 5 EMASGPAG----TKVLRFLYFVGAGFICTAAINKWRELERKSLQKKQQE 49