BLASTX nr result
ID: Rehmannia22_contig00022037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00022037 (543 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64663.1| hypothetical protein M569_10117 [Genlisea aurea] 59 6e-07 ref|XP_006341665.1| PREDICTED: plastidic ATP/ADP-transporter-lik... 59 1e-06 >gb|EPS64663.1| hypothetical protein M569_10117 [Genlisea aurea] Length = 631 Score = 59.3 bits (142), Expect = 6e-07 Identities = 34/62 (54%), Positives = 44/62 (70%), Gaps = 4/62 (6%) Frame = +3 Query: 369 MQAVLQSKGLLSLPSNPKIR---AFIAKPSCDL-RYRFNPISQPRTLNKSSSLLSLDGFS 536 MQAVLQS+G+LSLPSNPK F+++PSC L R+RF+P S+P + S+DGFS Sbjct: 1 MQAVLQSRGILSLPSNPKTNRGGGFVSQPSCGLRRFRFDPPSKPLLSS------SVDGFS 54 Query: 537 KF 542 KF Sbjct: 55 KF 56 >ref|XP_006341665.1| PREDICTED: plastidic ATP/ADP-transporter-like [Solanum tuberosum] Length = 626 Score = 58.5 bits (140), Expect = 1e-06 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = +3 Query: 369 MQAVLQSKGLLSLPSNPKIRAFIAKPSCDLRYRFNPISQPRTLNKSSSLLSLDGFSK 539 M+AVLQ+KGLLSLPS PKIRAF P LR+RFN + +P++L S LS DGF K Sbjct: 1 MEAVLQTKGLLSLPSKPKIRAFYPIPQGGLRHRFNSL-KPKSLEGLS--LSSDGFQK 54