BLASTX nr result
ID: Rehmannia22_contig00021769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00021769 (1351 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF64710.1| putative transposase [Ipomoea tricolor] 47 6e-10 gb|ESW21756.1| hypothetical protein PHAVU_005G096800g [Phaseolus... 42 2e-07 ref|NP_850486.2| Nucleic acid-binding, OB-fold-like protein [Ara... 43 4e-06 >dbj|BAF64710.1| putative transposase [Ipomoea tricolor] Length = 517 Score = 47.0 bits (110), Expect(2) = 6e-10 Identities = 19/44 (43%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = -2 Query: 1254 GNFWISAKIIANESGMDWWYIACTK--CSKKTTKIAGEFYCEKC 1129 G+FW++AKI+ ES DW+Y++C C+KK T + C+KC Sbjct: 291 GDFWVAAKIVGIESSWDWFYVSCKSHGCNKKLTLRNTLYDCDKC 334 Score = 45.1 bits (105), Expect(2) = 6e-10 Identities = 17/37 (45%), Positives = 28/37 (75%) Frame = -1 Query: 1111 RYKLQVRVADYTRNAAFLIWDRECIELIGKTAYELKE 1001 RY+++VR D NA F++WD+EC EL+G +A +L++ Sbjct: 344 RYRVKVRAVDLDGNAPFILWDKECTELLGISATDLRQ 380 >gb|ESW21756.1| hypothetical protein PHAVU_005G096800g [Phaseolus vulgaris] Length = 457 Score = 42.0 bits (97), Expect(3) = 2e-07 Identities = 22/50 (44%), Positives = 32/50 (64%) Frame = -1 Query: 1111 RYKLQVRVADYTRNAAFLIWDRECIELIGKTAYELKESSNEEVLS*YLDK 962 RYKL++RV D T + F+++DR+ LI K+ EL ES ++ V S L K Sbjct: 287 RYKLKLRVIDETNSTTFVLFDRDATTLINKSCAELFESHDKNVDSGVLPK 336 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 1206 DWWYIACTKCSKKTTKIAGEFYCEKCD 1126 DWWY C C K + F+CEKC+ Sbjct: 253 DWWYTTCL-CGKAVYPDSKMFFCEKCN 278 Score = 28.1 bits (61), Expect(3) = 2e-07 Identities = 18/68 (26%), Positives = 33/68 (48%) Frame = -3 Query: 857 IPKEIQDLVDKKLLFMVKIKTGQHKFFSGVLPVTKLTTDNTIIEKYHGLWNGSQQSDMFS 678 +PK+ L+DK +LF V Q+ F V K+ D++ I+++ + D+F+ Sbjct: 334 LPKDFDLLIDKVVLFKVGCVKYQYLRFDQSFRVKKVCIDDSTIQRF--CEGRVENVDLFN 391 Query: 677 KMKSADFD 654 K + D Sbjct: 392 KFSTEAAD 399 >ref|NP_850486.2| Nucleic acid-binding, OB-fold-like protein [Arabidopsis thaliana] gi|330250868|gb|AEC05962.1| Nucleic acid-binding, OB-fold-like protein [Arabidopsis thaliana] Length = 532 Score = 42.7 bits (99), Expect(2) = 4e-06 Identities = 19/37 (51%), Positives = 30/37 (81%) Frame = -1 Query: 1111 RYKLQVRVADYTRNAAFLIWDRECIELIGKTAYELKE 1001 R+++QV V D+T A+FL++D++ I+LI K+AYEL E Sbjct: 327 RFRVQVTVLDHTGEASFLLFDQDVIKLIHKSAYELLE 363 Score = 36.2 bits (82), Expect(2) = 4e-06 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 10/59 (16%) Frame = -2 Query: 1242 ISAKIIANESGMDWWYIACTKCSKKTTKI---------AGEFYCEKCD-FKDPIGTNFK 1096 I A I + ++ + W+YI C C KK + AG++ CEKCD F T F+ Sbjct: 271 IIASIFSIDTKVPWFYIGCNICFKKVSPYFNPETEEIEAGKYECEKCDTFVTTTSTRFR 329