BLASTX nr result
ID: Rehmannia22_contig00021583
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00021583 (348 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59528.1| hypothetical protein M569_15276, partial [Genlise... 65 7e-09 ref|XP_006350821.1| PREDICTED: peptide transporter PTR1-like [So... 65 9e-09 ref|XP_004241180.1| PREDICTED: peptide transporter PTR1-like [So... 64 2e-08 ref|XP_002298324.1| hypothetical protein POPTR_0001s25570g [Popu... 62 6e-08 emb|CBI30424.3| unnamed protein product [Vitis vinifera] 62 1e-07 emb|CAO02542.1| putative proton-dependent oligopeptide transport... 62 1e-07 ref|XP_006362448.1| PREDICTED: peptide transporter PTR1-like [So... 61 1e-07 ref|XP_004242802.1| PREDICTED: peptide transporter PTR1-like [So... 61 1e-07 ref|XP_004137914.1| PREDICTED: peptide transporter PTR5-like [Cu... 60 2e-07 ref|XP_002274041.2| PREDICTED: peptide transporter PTR1-like [Vi... 60 2e-07 ref|XP_003551296.1| PREDICTED: peptide transporter PTR1 [Glycine... 60 2e-07 emb|CAN72572.1| hypothetical protein VITISV_034788 [Vitis vinifera] 60 2e-07 gb|ESW18736.1| hypothetical protein PHAVU_006G065900g [Phaseolus... 60 3e-07 ref|XP_006429306.1| hypothetical protein CICLE_v10011381mg [Citr... 60 3e-07 gb|EOY07286.1| Peptide transporter 1 [Theobroma cacao] 60 3e-07 ref|XP_004246846.1| PREDICTED: uncharacterized protein LOC101268... 60 3e-07 gb|EMJ09491.1| hypothetical protein PRUPE_ppa003364mg [Prunus pe... 60 4e-07 gb|EOY33804.1| Peptide transporter 1 [Theobroma cacao] 59 5e-07 ref|XP_004308641.1| PREDICTED: peptide transporter PTR5-like [Fr... 59 5e-07 gb|EOY33803.1| Peptide transporter 1 [Theobroma cacao] 59 7e-07 >gb|EPS59528.1| hypothetical protein M569_15276, partial [Genlisea aurea] Length = 571 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAEDDLYTKDGTVD+H PAKK ETG+W+AC +IL Sbjct: 1 MAEDDLYTKDGTVDFHGNPAKKNETGSWKACPFIL 35 >ref|XP_006350821.1| PREDICTED: peptide transporter PTR1-like [Solanum tuberosum] Length = 574 Score = 65.1 bits (157), Expect = 9e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 236 KAMAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 + +AEDDLYTKDGTVD+ N PAKK ETGTW+AC +IL Sbjct: 3 EVVAEDDLYTKDGTVDFRNNPAKKNETGTWKACPFIL 39 >ref|XP_004241180.1| PREDICTED: peptide transporter PTR1-like [Solanum lycopersicum] Length = 574 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 236 KAMAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 + +AEDDLYTKDGTVD+ N PAK+ ETGTW+AC +IL Sbjct: 3 EVVAEDDLYTKDGTVDFRNNPAKRNETGTWKACPFIL 39 >ref|XP_002298324.1| hypothetical protein POPTR_0001s25570g [Populus trichocarpa] gi|222845582|gb|EEE83129.1| hypothetical protein POPTR_0001s25570g [Populus trichocarpa] Length = 570 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAE+D+YTKDGTVDY PA K ETGTWRAC YI+ Sbjct: 1 MAEEDVYTKDGTVDYRGNPANKKETGTWRACPYII 35 >emb|CBI30424.3| unnamed protein product [Vitis vinifera] Length = 1454 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +2 Query: 221 SVLGIKAMAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 SV+ MAEDD+YTKDGT++ HNKPA K +TG W+AC +IL Sbjct: 656 SVVFENTMAEDDMYTKDGTMNIHNKPANKKKTGQWKACRFIL 697 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAE+D+YTKDGT+D+ + PA K ETGTW+AC YIL Sbjct: 1 MAEEDIYTKDGTIDFRSNPAVKKETGTWKACPYIL 35 >emb|CAO02542.1| putative proton-dependent oligopeptide transport (POT) family protein [Vigna unguiculata] gi|149941222|emb|CAO02543.1| putative proton-dependent oligopeptide transport (POT) family protein [Vigna unguiculata] Length = 174 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAEDD+YTKDGTVD+ PA K ETGTWRAC +IL Sbjct: 1 MAEDDIYTKDGTVDHRGNPANKKETGTWRACPFIL 35 >ref|XP_006362448.1| PREDICTED: peptide transporter PTR1-like [Solanum tuberosum] Length = 584 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 248 EDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 E+D+YTKDGTVDY NKPA K +TGTW+AC YIL Sbjct: 4 EEDVYTKDGTVDYRNKPANKKKTGTWKACPYIL 36 >ref|XP_004242802.1| PREDICTED: peptide transporter PTR1-like [Solanum lycopersicum] Length = 584 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 248 EDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 E+D+YTKDGTVDY NKPA K +TGTW+AC YIL Sbjct: 4 EEDVYTKDGTVDYRNKPANKKKTGTWKACPYIL 36 >ref|XP_004137914.1| PREDICTED: peptide transporter PTR5-like [Cucumis sativus] Length = 569 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAEDD+YTKDGTVD H KPA K +TG W+AC +IL Sbjct: 1 MAEDDIYTKDGTVDVHKKPAIKKKTGNWKACRFIL 35 >ref|XP_002274041.2| PREDICTED: peptide transporter PTR1-like [Vitis vinifera] Length = 1120 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAEDD+YTKDGT++ HNKPA K +TG W+AC +IL Sbjct: 553 MAEDDMYTKDGTMNIHNKPANKKKTGQWKACRFIL 587 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAE+D+YTKDGT+D+ + PA K ETGTW+AC YIL Sbjct: 1 MAEEDIYTKDGTIDFRSNPAVKKETGTWKACPYIL 35 >ref|XP_003551296.1| PREDICTED: peptide transporter PTR1 [Glycine max] Length = 572 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAEDD YTKDGTVDY PA K ETGTW+AC YIL Sbjct: 1 MAEDDGYTKDGTVDYCGNPANKKETGTWKACPYIL 35 >emb|CAN72572.1| hypothetical protein VITISV_034788 [Vitis vinifera] Length = 568 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAEDD+YTKDGT++ HNKPA K +TG W+AC +IL Sbjct: 1 MAEDDMYTKDGTMNIHNKPANKKKTGQWKACRFIL 35 >gb|ESW18736.1| hypothetical protein PHAVU_006G065900g [Phaseolus vulgaris] Length = 570 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAEDD YTKDGTVDY PA K ETGTWRAC +IL Sbjct: 1 MAEDDGYTKDGTVDYCGNPANKKETGTWRACPFIL 35 >ref|XP_006429306.1| hypothetical protein CICLE_v10011381mg [Citrus clementina] gi|567873435|ref|XP_006429307.1| hypothetical protein CICLE_v10011381mg [Citrus clementina] gi|568854719|ref|XP_006480967.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Citrus sinensis] gi|568854721|ref|XP_006480968.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Citrus sinensis] gi|568854723|ref|XP_006480969.1| PREDICTED: peptide transporter PTR1-like isoform X3 [Citrus sinensis] gi|557531363|gb|ESR42546.1| hypothetical protein CICLE_v10011381mg [Citrus clementina] gi|557531364|gb|ESR42547.1| hypothetical protein CICLE_v10011381mg [Citrus clementina] Length = 568 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAE+D+YTKDGTVD H KPA K +TG W+AC +IL Sbjct: 1 MAEEDIYTKDGTVDIHKKPANKKKTGNWKACRFIL 35 >gb|EOY07286.1| Peptide transporter 1 [Theobroma cacao] Length = 515 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAE+D+YTKDGT D+ NKPA + +TGTW+AC YIL Sbjct: 1 MAEEDIYTKDGTTDFRNKPAIRNKTGTWKACPYIL 35 >ref|XP_004246846.1| PREDICTED: uncharacterized protein LOC101268606 [Solanum lycopersicum] Length = 1144 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/54 (46%), Positives = 37/54 (68%) Frame = +2 Query: 185 YSFINRKLVADKSVLGIKAMAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 + F+ + K+++G +M DD YTKDGT+D + +PA K +TGTW+AC YIL Sbjct: 560 FLFVAKFYTYKKAIIGPSSMDSDDDYTKDGTMDIYKRPANKKKTGTWKACPYIL 613 >gb|EMJ09491.1| hypothetical protein PRUPE_ppa003364mg [Prunus persica] Length = 581 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +2 Query: 236 KAMAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 KA A +D+YTKDGTVD+H PAK+ TGTW+AC +IL Sbjct: 9 KAAAAEDVYTKDGTVDFHGNPAKRNATGTWKACPFIL 45 >gb|EOY33804.1| Peptide transporter 1 [Theobroma cacao] Length = 575 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 MAEDD YTKDGTVDY PA K +TGTW+AC +I+ Sbjct: 1 MAEDDFYTKDGTVDYRGNPANKKKTGTWKACPFII 35 >ref|XP_004308641.1| PREDICTED: peptide transporter PTR5-like [Fragaria vesca subsp. vesca] Length = 586 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 +AEDDLYTKDGTVDY PA K TGTW+AC +IL Sbjct: 17 IAEDDLYTKDGTVDYRGNPANKNVTGTWKACPFIL 51 >gb|EOY33803.1| Peptide transporter 1 [Theobroma cacao] Length = 569 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +2 Query: 242 MAEDDLYTKDGTVDYHNKPAKKTETGTWRACHYIL 346 M +DD+YTKDGTVDY PA K ETGTWRAC +I+ Sbjct: 1 MEKDDIYTKDGTVDYKGNPANKKETGTWRACPFII 35