BLASTX nr result
ID: Rehmannia22_contig00021188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00021188 (392 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71053.1| hypothetical protein M569_03702 [Genlisea aurea] 102 5e-20 ref|XP_006477110.1| PREDICTED: pentatricopeptide repeat-containi... 102 7e-20 ref|XP_006440204.1| hypothetical protein CICLE_v10019492mg [Citr... 102 7e-20 ref|XP_002265980.2| PREDICTED: pentatricopeptide repeat-containi... 102 7e-20 emb|CBI23541.3| unnamed protein product [Vitis vinifera] 102 7e-20 ref|XP_004165812.1| PREDICTED: pentatricopeptide repeat-containi... 101 1e-19 ref|XP_004147229.1| PREDICTED: pentatricopeptide repeat-containi... 101 1e-19 ref|XP_004508953.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 emb|CAA06832.1| DYW10 protein [Arabidopsis thaliana] 100 3e-19 ref|XP_006578628.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_006578631.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_004963823.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 gb|EOY24222.1| Tetratricopeptide repeat (TPR)-like superfamily p... 100 3e-19 ref|XP_003564631.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 gb|EMT33444.1| hypothetical protein F775_20071 [Aegilops tauschii] 99 4e-19 ref|XP_002303374.2| hypothetical protein POPTR_0003s07960g [Popu... 98 1e-18 ref|XP_004970613.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 tpg|DAA50652.1| TPA: hypothetical protein ZEAMMB73_776700 [Zea m... 98 1e-18 ref|NP_001132746.1| uncharacterized protein LOC100194233 [Zea ma... 98 1e-18 ref|XP_006446832.1| hypothetical protein CICLE_v10018004mg [Citr... 97 2e-18 >gb|EPS71053.1| hypothetical protein M569_03702 [Genlisea aurea] Length = 571 Score = 102 bits (254), Expect = 5e-20 Identities = 44/55 (80%), Positives = 48/55 (87%) Frame = +3 Query: 9 ALDQPIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 ++D PI VFKNLRVC+DCHLAIKFIS IE R II+RDT RFHHFRDGKCSC DYW Sbjct: 517 SIDDPIMVFKNLRVCEDCHLAIKFISAIESRVIILRDTFRFHHFRDGKCSCNDYW 571 >ref|XP_006477110.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Citrus sinensis] Length = 669 Score = 102 bits (253), Expect = 7e-20 Identities = 45/57 (78%), Positives = 48/57 (84%) Frame = +3 Query: 3 RVALDQPIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 +V L PIRVFKNLRVC DCH A K+IS IE REIIVRDTTRFHHF+DG CSCGDYW Sbjct: 613 KVPLGTPIRVFKNLRVCGDCHRATKYISAIEKREIIVRDTTRFHHFKDGTCSCGDYW 669 >ref|XP_006440204.1| hypothetical protein CICLE_v10019492mg [Citrus clementina] gi|557542466|gb|ESR53444.1| hypothetical protein CICLE_v10019492mg [Citrus clementina] Length = 571 Score = 102 bits (253), Expect = 7e-20 Identities = 45/57 (78%), Positives = 48/57 (84%) Frame = +3 Query: 3 RVALDQPIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 +V L PIRVFKNLRVC DCH A K+IS IE REIIVRDTTRFHHF+DG CSCGDYW Sbjct: 515 KVPLGTPIRVFKNLRVCGDCHRATKYISAIEKREIIVRDTTRFHHFKDGTCSCGDYW 571 >ref|XP_002265980.2| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like, partial [Vitis vinifera] Length = 599 Score = 102 bits (253), Expect = 7e-20 Identities = 45/57 (78%), Positives = 48/57 (84%) Frame = +3 Query: 3 RVALDQPIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 R+ L PIRVFKNLRVC DCH A K+IS IEGR IIVRDTTRFHHFR G+CSCGDYW Sbjct: 543 RMPLGTPIRVFKNLRVCGDCHSATKYISAIEGRVIIVRDTTRFHHFRQGECSCGDYW 599 >emb|CBI23541.3| unnamed protein product [Vitis vinifera] Length = 385 Score = 102 bits (253), Expect = 7e-20 Identities = 45/57 (78%), Positives = 48/57 (84%) Frame = +3 Query: 3 RVALDQPIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 R+ L PIRVFKNLRVC DCH A K+IS IEGR IIVRDTTRFHHFR G+CSCGDYW Sbjct: 329 RMPLGTPIRVFKNLRVCGDCHSATKYISAIEGRVIIVRDTTRFHHFRQGECSCGDYW 385 >ref|XP_004165812.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cucumis sativus] Length = 667 Score = 101 bits (251), Expect = 1e-19 Identities = 46/57 (80%), Positives = 48/57 (84%) Frame = +3 Query: 3 RVALDQPIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 + A PIRVFKNLRVC DCH AIKFIS IE REIIVRDTTRFHHFR+G CSCGDYW Sbjct: 611 KTAPGTPIRVFKNLRVCGDCHRAIKFISAIEKREIIVRDTTRFHHFRNGFCSCGDYW 667 >ref|XP_004147229.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cucumis sativus] Length = 667 Score = 101 bits (251), Expect = 1e-19 Identities = 46/57 (80%), Positives = 48/57 (84%) Frame = +3 Query: 3 RVALDQPIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 + A PIRVFKNLRVC DCH AIKFIS IE REIIVRDTTRFHHFR+G CSCGDYW Sbjct: 611 KTAPGTPIRVFKNLRVCGDCHRAIKFISAIEKREIIVRDTTRFHHFRNGFCSCGDYW 667 >ref|XP_004508953.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cicer arietinum] Length = 637 Score = 100 bits (250), Expect = 2e-19 Identities = 45/57 (78%), Positives = 48/57 (84%) Frame = +3 Query: 3 RVALDQPIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 +V L PIRVFKNLRVC DCH AIK+IS IE REIIVRDTTRFHHF+DG CSC DYW Sbjct: 581 KVPLGVPIRVFKNLRVCGDCHSAIKYISAIEEREIIVRDTTRFHHFKDGLCSCSDYW 637 >emb|CAA06832.1| DYW10 protein [Arabidopsis thaliana] Length = 105 Score = 100 bits (248), Expect = 3e-19 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +3 Query: 21 PIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 PI+VFKNLR+C DCH AIKFIS IE REIIVRDTTRFHHF+DG CSCGDYW Sbjct: 55 PIQVFKNLRICGDCHKAIKFISEIEKREIIVRDTTRFHHFKDGSCSCGDYW 105 >ref|XP_006578628.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X2 [Glycine max] gi|571451096|ref|XP_003522381.2| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X1 [Glycine max] gi|571451098|ref|XP_006578629.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X3 [Glycine max] gi|571451100|ref|XP_006578630.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X4 [Glycine max] Length = 640 Score = 100 bits (248), Expect = 3e-19 Identities = 45/57 (78%), Positives = 48/57 (84%) Frame = +3 Query: 3 RVALDQPIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 +V L PIRVFKNLRVC DCH A K+IS IEGREIIVRDTTRFHHF+DG CSC DYW Sbjct: 579 KVPLGVPIRVFKNLRVCGDCHSATKYISTIEGREIIVRDTTRFHHFKDGFCSCRDYW 635 >ref|XP_006578631.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X5 [Glycine max] gi|571451104|ref|XP_006578632.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X6 [Glycine max] gi|571451106|ref|XP_006578633.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X7 [Glycine max] Length = 635 Score = 100 bits (248), Expect = 3e-19 Identities = 45/57 (78%), Positives = 48/57 (84%) Frame = +3 Query: 3 RVALDQPIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 +V L PIRVFKNLRVC DCH A K+IS IEGREIIVRDTTRFHHF+DG CSC DYW Sbjct: 579 KVPLGVPIRVFKNLRVCGDCHSATKYISTIEGREIIVRDTTRFHHFKDGFCSCRDYW 635 >ref|XP_004963823.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Setaria italica] Length = 669 Score = 99.8 bits (247), Expect = 3e-19 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = +3 Query: 21 PIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 P+RV KNLR+CDDCH A+KFIS EGREI VRDT RFHHFRDGKCSCGDYW Sbjct: 619 PLRVIKNLRICDDCHEAMKFISCFEGREISVRDTNRFHHFRDGKCSCGDYW 669 >gb|EOY24222.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 685 Score = 99.8 bits (247), Expect = 3e-19 Identities = 43/51 (84%), Positives = 45/51 (88%) Frame = +3 Query: 21 PIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 PIRVFKNLRVC DCH AIK+IS IE REIIVRDT RFHHF+DG CSCGDYW Sbjct: 635 PIRVFKNLRVCGDCHRAIKYISAIETREIIVRDTVRFHHFKDGSCSCGDYW 685 >ref|XP_003564631.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Brachypodium distachyon] Length = 647 Score = 99.8 bits (247), Expect = 3e-19 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +3 Query: 21 PIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 PIRV KNLRVCDDCH+AIK IS + GREI+VRD +RFHHFRDG+CSCGDYW Sbjct: 597 PIRVMKNLRVCDDCHVAIKLISQVTGREIVVRDVSRFHHFRDGRCSCGDYW 647 >gb|EMT33444.1| hypothetical protein F775_20071 [Aegilops tauschii] Length = 647 Score = 99.4 bits (246), Expect = 4e-19 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +3 Query: 21 PIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 PIR+ KNLRVCDDCH+AIK +S + GREI+VRD +RFHHFRDGKCSCGDYW Sbjct: 597 PIRIMKNLRVCDDCHVAIKLMSQVTGREIVVRDVSRFHHFRDGKCSCGDYW 647 >ref|XP_002303374.2| hypothetical protein POPTR_0003s07960g [Populus trichocarpa] gi|550342672|gb|EEE78353.2| hypothetical protein POPTR_0003s07960g [Populus trichocarpa] Length = 589 Score = 98.2 bits (243), Expect = 1e-18 Identities = 43/51 (84%), Positives = 45/51 (88%) Frame = +3 Query: 21 PIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 PIRVFKNLRVC DCH AIK+IS IE REIIVRDTTRFHHF+DG CSC DYW Sbjct: 539 PIRVFKNLRVCGDCHRAIKYISQIERREIIVRDTTRFHHFKDGHCSCADYW 589 >ref|XP_004970613.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Setaria italica] Length = 647 Score = 98.2 bits (243), Expect = 1e-18 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +3 Query: 21 PIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 PIR+ KNLRVCDDCH+AIK +S + GREI+VRD +RFHHF+DGKCSCGDYW Sbjct: 597 PIRIMKNLRVCDDCHVAIKLMSKVTGREIVVRDVSRFHHFKDGKCSCGDYW 647 >tpg|DAA50652.1| TPA: hypothetical protein ZEAMMB73_776700 [Zea mays] Length = 647 Score = 97.8 bits (242), Expect = 1e-18 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +3 Query: 21 PIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 PIRV KNLRVCDDCH+AIK +S + GREI+VRD +RFHHF+DGKCSCGDYW Sbjct: 597 PIRVMKNLRVCDDCHVAIKLMSKVIGREIVVRDVSRFHHFKDGKCSCGDYW 647 >ref|NP_001132746.1| uncharacterized protein LOC100194233 [Zea mays] gi|194695290|gb|ACF81729.1| unknown [Zea mays] Length = 539 Score = 97.8 bits (242), Expect = 1e-18 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +3 Query: 21 PIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 PIRV KNLRVCDDCH+AIK +S + GREI+VRD +RFHHF+DGKCSCGDYW Sbjct: 489 PIRVMKNLRVCDDCHVAIKLMSKVIGREIVVRDVSRFHHFKDGKCSCGDYW 539 >ref|XP_006446832.1| hypothetical protein CICLE_v10018004mg [Citrus clementina] gi|557549443|gb|ESR60072.1| hypothetical protein CICLE_v10018004mg [Citrus clementina] Length = 632 Score = 97.4 bits (241), Expect = 2e-18 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +3 Query: 21 PIRVFKNLRVCDDCHLAIKFISGIEGREIIVRDTTRFHHFRDGKCSCGDYW 173 PIRV KNLRVC DCH+AIK+IS I+ REIIVRD++RFHHFR+GKCSCGDYW Sbjct: 582 PIRVMKNLRVCSDCHVAIKYISEIKNREIIVRDSSRFHHFRNGKCSCGDYW 632