BLASTX nr result
ID: Rehmannia22_contig00020492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00020492 (407 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD98038.1| acetylajmalan acetylesterase [Striga asiatica] 69 7e-10 >gb|ABD98038.1| acetylajmalan acetylesterase [Striga asiatica] Length = 406 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/60 (56%), Positives = 43/60 (71%) Frame = +3 Query: 228 AADFGLPHVIPFLSMNALNASKSYDGAIFSVARSPVLDTTFFRTKHVTIPSYAVSLQKQL 407 A D GLP++ P+L+MN NA+ SYDG IFSVARSPVL FF + + IP Y VSL +Q+ Sbjct: 94 AQDLGLPNIRPYLNMNQSNAA-SYDGVIFSVARSPVLGRKFFEKRDIVIPRYTVSLSQQM 152