BLASTX nr result
ID: Rehmannia22_contig00020464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00020464 (744 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006465512.1| PREDICTED: pleiotropic drug resistance prote... 82 2e-13 ref|XP_006427143.1| hypothetical protein CICLE_v10024714mg [Citr... 79 1e-12 ref|XP_004252847.1| PREDICTED: pleiotropic drug resistance prote... 78 3e-12 sp|Q949G3.1|PDR1_NICPL RecName: Full=Pleiotropic drug resistance... 77 8e-12 ref|XP_006365806.1| PREDICTED: pleiotropic drug resistance prote... 77 8e-12 ref|XP_004239867.1| PREDICTED: pleiotropic drug resistance prote... 77 8e-12 ref|XP_004239866.1| PREDICTED: pleiotropic drug resistance prote... 76 1e-11 ref|XP_006476216.1| PREDICTED: pleiotropic drug resistance prote... 76 1e-11 ref|XP_006476215.1| PREDICTED: pleiotropic drug resistance prote... 76 1e-11 ref|XP_006476214.1| PREDICTED: pleiotropic drug resistance prote... 76 1e-11 ref|XP_006476213.1| PREDICTED: pleiotropic drug resistance prote... 76 1e-11 ref|XP_006450535.1| hypothetical protein CICLE_v10010431mg [Citr... 76 1e-11 ref|XP_006441387.1| hypothetical protein CICLE_v10018487mg [Citr... 76 1e-11 ref|XP_004156752.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic ... 76 1e-11 ref|XP_004148099.1| PREDICTED: pleiotropic drug resistance prote... 76 1e-11 gb|ACU82515.1| pleiotropic drug resistance protein [Cucumis sati... 76 1e-11 ref|XP_006465412.1| PREDICTED: pleiotropic drug resistance prote... 75 2e-11 ref|XP_006427144.1| hypothetical protein CICLE_v10024707mg [Citr... 75 2e-11 ref|XP_006360348.1| PREDICTED: pleiotropic drug resistance prote... 75 2e-11 gb|ESW34602.1| hypothetical protein PHAVU_001G165700g [Phaseolus... 75 2e-11 >ref|XP_006465512.1| PREDICTED: pleiotropic drug resistance protein 1-like [Citrus sinensis] Length = 1453 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQASKL 145 KSHPAAL+T+KYG+GKKELLKAC RELLLMKRNSFVYFFK FQ + + Sbjct: 487 KSHPAALTTKKYGVGKKELLKACNSRELLLMKRNSFVYFFKLFQLTTI 534 >ref|XP_006427143.1| hypothetical protein CICLE_v10024714mg [Citrus clementina] gi|557529133|gb|ESR40383.1| hypothetical protein CICLE_v10024714mg [Citrus clementina] Length = 1393 Score = 79.3 bits (194), Expect = 1e-12 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQASKL 145 KSHPAAL+T+KYG+GKKE LKAC RELLLMKRNSFVYFFK FQ + + Sbjct: 476 KSHPAALTTKKYGVGKKESLKACNSRELLLMKRNSFVYFFKLFQLTTI 523 >ref|XP_004252847.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum lycopersicum] Length = 1435 Score = 78.2 bits (191), Expect = 3e-12 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAALSTQKYGIGKK+LLK C +RELLLMKRNSFVY FK Q Sbjct: 502 KSHPAALSTQKYGIGKKQLLKVCTERELLLMKRNSFVYIFKFIQ 545 >sp|Q949G3.1|PDR1_NICPL RecName: Full=Pleiotropic drug resistance protein 1; AltName: Full=NpPDR1 gi|14331118|emb|CAC40990.1| ABC1 protein [Nicotiana plumbaginifolia] Length = 1436 Score = 76.6 bits (187), Expect = 8e-12 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+TQKYGIGK++LLK C +RELLLM+RNSFVY FK FQ Sbjct: 499 KSHPAALTTQKYGIGKRQLLKVCTERELLLMQRNSFVYLFKFFQ 542 >ref|XP_006365806.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum tuberosum] Length = 1435 Score = 76.6 bits (187), Expect = 8e-12 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAALSTQKYGIGKK+LLK C +RE LLMKRNSFVY FK Q Sbjct: 502 KSHPAALSTQKYGIGKKQLLKVCTEREFLLMKRNSFVYIFKFIQ 545 >ref|XP_004239867.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum lycopersicum] Length = 1410 Score = 76.6 bits (187), Expect = 8e-12 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAALSTQKYG+G KE+LK C +RE LLMKRNSFVY FK FQ Sbjct: 484 KSHPAALSTQKYGLGTKEMLKVCAEREFLLMKRNSFVYIFKLFQ 527 >ref|XP_004239866.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum lycopersicum] Length = 1412 Score = 76.3 bits (186), Expect = 1e-11 Identities = 36/44 (81%), Positives = 37/44 (84%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAALSTQKYGIG KELL C +RE LLMKRNSFVY FK FQ Sbjct: 484 KSHPAALSTQKYGIGTKELLNVCAEREFLLMKRNSFVYIFKLFQ 527 >ref|XP_006476216.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform X4 [Citrus sinensis] Length = 1446 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+T+KYG KKELLKAC RE LLMKRNSFVYFFK FQ Sbjct: 488 KSHPAALTTKKYGASKKELLKACFAREYLLMKRNSFVYFFKMFQ 531 >ref|XP_006476215.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform X3 [Citrus sinensis] Length = 1450 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+T+KYG KKELLKAC RE LLMKRNSFVYFFK FQ Sbjct: 488 KSHPAALTTKKYGASKKELLKACFAREYLLMKRNSFVYFFKMFQ 531 >ref|XP_006476214.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform X2 [Citrus sinensis] Length = 1452 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+T+KYG KKELLKAC RE LLMKRNSFVYFFK FQ Sbjct: 488 KSHPAALTTKKYGASKKELLKACFAREYLLMKRNSFVYFFKMFQ 531 >ref|XP_006476213.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform X1 [Citrus sinensis] Length = 1463 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+T+KYG KKELLKAC RE LLMKRNSFVYFFK FQ Sbjct: 488 KSHPAALTTKKYGASKKELLKACFAREYLLMKRNSFVYFFKMFQ 531 >ref|XP_006450535.1| hypothetical protein CICLE_v10010431mg [Citrus clementina] gi|557553761|gb|ESR63775.1| hypothetical protein CICLE_v10010431mg [Citrus clementina] Length = 1452 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+T+KYG KKELLKAC RE LLMKRNSFVYFFK FQ Sbjct: 488 KSHPAALTTKKYGASKKELLKACFAREYLLMKRNSFVYFFKMFQ 531 >ref|XP_006441387.1| hypothetical protein CICLE_v10018487mg [Citrus clementina] gi|557543649|gb|ESR54627.1| hypothetical protein CICLE_v10018487mg [Citrus clementina] Length = 1455 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQASKL 145 KSHPAAL+T+KYG+GKKELLKA I RELLLMKRNSFVY FK Q S + Sbjct: 487 KSHPAALTTKKYGVGKKELLKANISRELLLMKRNSFVYIFKLTQLSSM 534 >ref|XP_004156752.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 1-like [Cucumis sativus] Length = 1451 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+T+KYG KKELLKACI RELLLMKRNSFVY FK Q Sbjct: 485 KSHPAALTTEKYGASKKELLKACISRELLLMKRNSFVYIFKLIQ 528 >ref|XP_004148099.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cucumis sativus] Length = 1451 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+T+KYG KKELLKACI RELLLMKRNSFVY FK Q Sbjct: 485 KSHPAALTTEKYGASKKELLKACISRELLLMKRNSFVYIFKLIQ 528 >gb|ACU82515.1| pleiotropic drug resistance protein [Cucumis sativus] Length = 1451 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+T+KYG KKELLKACI RELLLMKRNSFVY FK Q Sbjct: 485 KSHPAALTTEKYGASKKELLKACISRELLLMKRNSFVYIFKLIQ 528 >ref|XP_006465412.1| PREDICTED: pleiotropic drug resistance protein 1-like [Citrus sinensis] Length = 1454 Score = 75.5 bits (184), Expect = 2e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+T+ YGI KKELLKACI RELLLMKRNSFVY FK Q Sbjct: 484 KSHPAALTTKSYGINKKELLKACISRELLLMKRNSFVYIFKLIQ 527 >ref|XP_006427144.1| hypothetical protein CICLE_v10024707mg [Citrus clementina] gi|557529134|gb|ESR40384.1| hypothetical protein CICLE_v10024707mg [Citrus clementina] Length = 1454 Score = 75.5 bits (184), Expect = 2e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+T+ YGI KKELLKACI RELLLMKRNSFVY FK Q Sbjct: 484 KSHPAALTTKSYGINKKELLKACISRELLLMKRNSFVYIFKLIQ 527 >ref|XP_006360348.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum tuberosum] Length = 1433 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+T+KYGIGKK+LLK C +RE LLM+RNSFVY FK FQ Sbjct: 495 KSHPAALTTEKYGIGKKQLLKVCTEREFLLMQRNSFVYIFKFFQ 538 >gb|ESW34602.1| hypothetical protein PHAVU_001G165700g [Phaseolus vulgaris] Length = 1456 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +2 Query: 2 KSHPAALSTQKYGIGKKELLKACIDRELLLMKRNSFVYFFKTFQ 133 KSHPAAL+T+KYG+GK ELLKAC+ RE LLMKRNSFVY FK FQ Sbjct: 481 KSHPAALTTKKYGVGKWELLKACLSREYLLMKRNSFVYTFKLFQ 524