BLASTX nr result
ID: Rehmannia22_contig00020352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00020352 (341 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66903.1| hypothetical protein M569_07873, partial [Genlise... 60 3e-07 >gb|EPS66903.1| hypothetical protein M569_07873, partial [Genlisea aurea] Length = 381 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/60 (50%), Positives = 40/60 (66%) Frame = +2 Query: 143 MGRWRAPLIVSRIISASKSINNLNFHKAPPHRSQNSPLIPKPRDYFSNFRSFSALPSVSP 322 MGRWR P+I+ I+ ASKSI NLN + +S + ++ +PR + SN R FSALPS SP Sbjct: 1 MGRWRTPVILDHILRASKSIGNLNSSRNACPKSLFASIVLQPRIFLSNLRWFSALPSPSP 60