BLASTX nr result
ID: Rehmannia22_contig00019803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00019803 (561 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68349.1| hypothetical protein M569_06422 [Genlisea aurea] 62 7e-08 >gb|EPS68349.1| hypothetical protein M569_06422 [Genlisea aurea] Length = 89 Score = 62.4 bits (150), Expect = 7e-08 Identities = 35/60 (58%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = +2 Query: 383 QSKFESSVLPKLGHCRLIAVPMDATTSGPSSVQYHNIADQ-TIASLAPPPVTHQRQQRHC 559 +SK +S+++ GHCR AVPMDATTSG SSVQYH IADQ I +L PV ++QRHC Sbjct: 18 KSKSDSNLIN--GHCRFEAVPMDATTSGASSVQYHTIADQKAIGALVSNPVV--KRQRHC 73