BLASTX nr result
ID: Rehmannia22_contig00019302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00019302 (457 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006338331.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 65 1e-08 ref|XP_004232134.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 64 2e-08 ref|XP_004233394.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 63 4e-08 ref|XP_006365653.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 62 8e-08 gb|EPS71582.1| hypothetical protein M569_03180 [Genlisea aurea] 56 4e-06 >ref|XP_006338331.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X1 [Solanum tuberosum] gi|565342375|ref|XP_006338332.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X2 [Solanum tuberosum] Length = 226 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +3 Query: 366 MGAACCCLRDEWEDFANPNSSIYRNCICL 452 MGA CCCLRDE EDFANPNSSIYRNCICL Sbjct: 1 MGAVCCCLRDECEDFANPNSSIYRNCICL 29 >ref|XP_004232134.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Solanum lycopersicum] Length = 226 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 366 MGAACCCLRDEWEDFANPNSSIYRNCICL 452 MGA CCCLRDE EDFANPNSSIYRNC+CL Sbjct: 1 MGAVCCCLRDECEDFANPNSSIYRNCLCL 29 >ref|XP_004233394.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Solanum lycopersicum] Length = 224 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 366 MGAACCCLRDEWEDFANPNSSIYRNCIC 449 MGA CCCLRDE EDFANPNSSIYRNCIC Sbjct: 1 MGAVCCCLRDECEDFANPNSSIYRNCIC 28 >ref|XP_006365653.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Solanum tuberosum] Length = 224 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 366 MGAACCCLRDEWEDFANPNSSIYRNCIC 449 MGA CCCLRDE EDFANPNSS+YRNCIC Sbjct: 1 MGAVCCCLRDECEDFANPNSSMYRNCIC 28 >gb|EPS71582.1| hypothetical protein M569_03180 [Genlisea aurea] Length = 229 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +3 Query: 366 MGAACCCLRDEWEDFANPNSSIYRNCICLH 455 MGA CCCLRD+WE+F+ S+I RNCICLH Sbjct: 1 MGAVCCCLRDDWENFSRSTSTICRNCICLH 30