BLASTX nr result
ID: Rehmannia22_contig00019110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00019110 (490 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528727.1| protease U48 caax prenyl protease rce1, puta... 57 3e-06 ref|XP_002309046.1| CAAX amino terminal protease family protein ... 56 4e-06 ref|XP_006341128.1| PREDICTED: CAAX prenyl protease 2-like [Sola... 55 1e-05 ref|XP_004246532.1| PREDICTED: CAAX prenyl protease 2-like [Sola... 55 1e-05 >ref|XP_002528727.1| protease U48 caax prenyl protease rce1, putative [Ricinus communis] gi|223531821|gb|EEF33639.1| protease U48 caax prenyl protease rce1, putative [Ricinus communis] Length = 257 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -1 Query: 490 GHLTAPLVAHIFCNFMGLPVIFSRRSGM*IDLSFS 386 GHL APLVAHIFCNFMGLPV+ +RR+GM + L + Sbjct: 220 GHLLAPLVAHIFCNFMGLPVVLARRTGMPVQLQLN 254 >ref|XP_002309046.1| CAAX amino terminal protease family protein [Populus trichocarpa] gi|222855022|gb|EEE92569.1| CAAX amino terminal protease family protein [Populus trichocarpa] Length = 270 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 490 GHLTAPLVAHIFCNFMGLPVIFSRRSGM 407 GHL APLVAHIFCNFMGLPV+F RR+GM Sbjct: 243 GHLVAPLVAHIFCNFMGLPVLFVRRTGM 270 >ref|XP_006341128.1| PREDICTED: CAAX prenyl protease 2-like [Solanum tuberosum] Length = 322 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -1 Query: 490 GHLTAPLVAHIFCNFMGLPVIFSRRSGM 407 GHLTAPLVAHIFCN+ G+PVI SRR+GM Sbjct: 253 GHLTAPLVAHIFCNYFGIPVIISRRTGM 280 >ref|XP_004246532.1| PREDICTED: CAAX prenyl protease 2-like [Solanum lycopersicum] Length = 335 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -1 Query: 490 GHLTAPLVAHIFCNFMGLPVIFSRRSGM 407 GHLTAPLVAHIFCN+ G+PVI SRR+GM Sbjct: 266 GHLTAPLVAHIFCNYFGIPVIISRRTGM 293