BLASTX nr result
ID: Rehmannia22_contig00018808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00018808 (459 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348871.1| PREDICTED: proteasome subunit alpha type-2-B... 80 4e-13 ref|XP_004243286.1| PREDICTED: proteasome subunit alpha type-2-B... 80 4e-13 gb|EPS72024.1| proteasome subunit alpha type [Genlisea aurea] 79 6e-13 ref|XP_004248192.1| PREDICTED: proteasome subunit alpha type-2-A... 79 8e-13 ref|XP_006364101.1| PREDICTED: proteasome subunit alpha type-2-A... 79 8e-13 ref|XP_004293762.1| PREDICTED: proteasome subunit alpha type-2-A... 76 4e-12 ref|XP_004145441.1| PREDICTED: proteasome subunit alpha type-2-B... 75 7e-12 gb|EMJ13144.1| hypothetical protein PRUPE_ppa010805mg [Prunus pe... 75 9e-12 ref|NP_173096.1| 20S proteasome subunit PAB1 [Arabidopsis thalia... 75 1e-11 ref|NP_178042.1| proteasome subunit alpha type-2-B [Arabidopsis ... 75 1e-11 ref|XP_002890168.1| hypothetical protein ARALYDRAFT_471845 [Arab... 75 1e-11 ref|XP_002889236.1| hypothetical protein ARALYDRAFT_895825 [Arab... 75 1e-11 ref|XP_002675300.1| predicted protein [Naegleria gruberi] gi|284... 75 1e-11 gb|AAK95291.1|AF410305_1 At1g16470/F3O9_27 [Arabidopsis thaliana... 75 1e-11 ref|XP_002278126.1| PREDICTED: proteasome subunit alpha type-2-B... 74 2e-11 ref|XP_006584582.1| PREDICTED: uncharacterized protein LOC100799... 74 2e-11 ref|XP_006584581.1| PREDICTED: uncharacterized protein LOC100799... 74 2e-11 ref|XP_006576205.1| PREDICTED: uncharacterized protein LOC100527... 74 2e-11 ref|XP_006576203.1| PREDICTED: uncharacterized protein LOC100527... 74 2e-11 gb|ESW21300.1| hypothetical protein PHAVU_005G059300g [Phaseolus... 74 2e-11 >ref|XP_006348871.1| PREDICTED: proteasome subunit alpha type-2-B-like [Solanum tuberosum] Length = 235 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/44 (81%), Positives = 44/44 (100%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQISSKNIEIG+IG++K+F++LTP+EI+DYLQEVE Sbjct: 192 ILTLKEGFEGQISSKNIEIGIIGTDKVFRILTPTEIDDYLQEVE 235 >ref|XP_004243286.1| PREDICTED: proteasome subunit alpha type-2-B-like [Solanum lycopersicum] Length = 235 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/44 (81%), Positives = 44/44 (100%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQISSKNIEIG+IG++K+F++LTP+EI+DYLQEVE Sbjct: 192 ILTLKEGFEGQISSKNIEIGIIGTDKVFRILTPTEIDDYLQEVE 235 >gb|EPS72024.1| proteasome subunit alpha type [Genlisea aurea] Length = 235 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQIS KNIEIGVIG+++IF+VL+PSEIEDYLQEVE Sbjct: 192 ILTLKEGFEGQISGKNIEIGVIGNDRIFRVLSPSEIEDYLQEVE 235 >ref|XP_004248192.1| PREDICTED: proteasome subunit alpha type-2-A-like [Solanum lycopersicum] Length = 235 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/44 (81%), Positives = 43/44 (97%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQIS KNIEIG+IG++K+F+VLTP+EI+DYLQEVE Sbjct: 192 ILTLKEGFEGQISGKNIEIGIIGNDKVFRVLTPAEIDDYLQEVE 235 >ref|XP_006364101.1| PREDICTED: proteasome subunit alpha type-2-A [Solanum tuberosum] gi|77416969|gb|ABA81880.1| unknown [Solanum tuberosum] Length = 235 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/44 (81%), Positives = 43/44 (97%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQIS KNIEIG+IG++K+F+VLTP+EI+DYLQEVE Sbjct: 192 ILTLKEGFEGQISGKNIEIGIIGNDKVFRVLTPAEIDDYLQEVE 235 >ref|XP_004293762.1| PREDICTED: proteasome subunit alpha type-2-A-like [Fragaria vesca subsp. vesca] Length = 235 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQIS KNIEIGVIG +KIF+VL+P+EIEDYL EVE Sbjct: 192 ILTLKEGFEGQISGKNIEIGVIGEDKIFRVLSPAEIEDYLAEVE 235 >ref|XP_004145441.1| PREDICTED: proteasome subunit alpha type-2-B-like [Cucumis sativus] gi|449487656|ref|XP_004157735.1| PREDICTED: proteasome subunit alpha type-2-B-like [Cucumis sativus] Length = 235 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQISSKNIEIG+IG++K F+VLTP+EI+DYL EVE Sbjct: 192 ILTLKEGFEGQISSKNIEIGIIGTDKKFRVLTPAEIDDYLAEVE 235 >gb|EMJ13144.1| hypothetical protein PRUPE_ppa010805mg [Prunus persica] Length = 235 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQIS KNIEIG+IG++K F+VLTP+EIEDYL EVE Sbjct: 192 ILTLKEGFEGQISGKNIEIGIIGTDKKFRVLTPAEIEDYLAEVE 235 >ref|NP_173096.1| 20S proteasome subunit PAB1 [Arabidopsis thaliana] gi|79318062|ref|NP_001031057.1| 20S proteasome subunit PAB1 [Arabidopsis thaliana] gi|565491374|ref|XP_006303326.1| hypothetical protein CARUB_v10010173mg [Capsella rubella] gi|567119616|ref|XP_006389910.1| hypothetical protein EUTSA_v10018943mg [Eutrema salsugineum] gi|567119619|ref|XP_006389911.1| hypothetical protein EUTSA_v10018943mg [Eutrema salsugineum] gi|567151044|ref|XP_006416814.1| hypothetical protein EUTSA_v10008648mg [Eutrema salsugineum] gi|6093778|sp|O23708.1|PSA2A_ARATH RecName: Full=Proteasome subunit alpha type-2-A; AltName: Full=20S proteasome alpha subunit B-1; AltName: Full=Proteasome component 3 gi|4966368|gb|AAD34699.1|AC006341_27 Identical to gb|Y13176 Arabidopsis thaliana mRNA for proteasome subunit prc3. ESTs gb|H36972, gb|T22551 and gb|T13800 come from this gene [Arabidopsis thaliana] gi|12083342|gb|AAG48830.1|AF332467_1 putative multicatalytic endopeptidase [Arabidopsis thaliana] gi|2511574|emb|CAA73619.1| multicatalytic endopeptidase [Arabidopsis thaliana] gi|3421075|gb|AAC32056.1| 20S proteasome subunit PAB1 [Arabidopsis thaliana] gi|21617900|gb|AAM66950.1| multicatalytic endopeptidase [Arabidopsis thaliana] gi|222423615|dbj|BAH19776.1| AT1G16470 [Arabidopsis thaliana] gi|222424243|dbj|BAH20079.1| AT1G16470 [Arabidopsis thaliana] gi|332191336|gb|AEE29457.1| 20S proteasome subunit PAB1 [Arabidopsis thaliana] gi|332191337|gb|AEE29458.1| 20S proteasome subunit PAB1 [Arabidopsis thaliana] gi|482572037|gb|EOA36224.1| hypothetical protein CARUB_v10010173mg [Capsella rubella] gi|557086344|gb|ESQ27196.1| hypothetical protein EUTSA_v10018943mg [Eutrema salsugineum] gi|557086345|gb|ESQ27197.1| hypothetical protein EUTSA_v10018943mg [Eutrema salsugineum] gi|557094585|gb|ESQ35167.1| hypothetical protein EUTSA_v10008648mg [Eutrema salsugineum] Length = 235 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEG+ISSKNIEIG IG++K+F+VLTP+EI+DYL EVE Sbjct: 192 ILTLKEGFEGEISSKNIEIGKIGADKVFRVLTPAEIDDYLAEVE 235 >ref|NP_178042.1| proteasome subunit alpha type-2-B [Arabidopsis thaliana] gi|145327739|ref|NP_001077845.1| proteasome subunit alpha type-2-B [Arabidopsis thaliana] gi|145327741|ref|NP_001077846.1| proteasome subunit alpha type-2-B [Arabidopsis thaliana] gi|75245585|sp|Q8L4A7.1|PSA2B_ARATH RecName: Full=Proteasome subunit alpha type-2-B; AltName: Full=20S proteasome alpha subunit B-2 gi|20453128|gb|AAM19806.1| At1g79210/YUP8H12R_1 [Arabidopsis thaliana] gi|21689609|gb|AAM67426.1| At1g79210/YUP8H12R_1 [Arabidopsis thaliana] gi|332198094|gb|AEE36215.1| proteasome subunit alpha type-2-B [Arabidopsis thaliana] gi|332198095|gb|AEE36216.1| proteasome subunit alpha type-2-B [Arabidopsis thaliana] gi|332198096|gb|AEE36217.1| proteasome subunit alpha type-2-B [Arabidopsis thaliana] Length = 235 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEG+ISSKNIEIG IG++K+F+VLTP+EI+DYL EVE Sbjct: 192 ILTLKEGFEGEISSKNIEIGKIGTDKVFRVLTPAEIDDYLAEVE 235 >ref|XP_002890168.1| hypothetical protein ARALYDRAFT_471845 [Arabidopsis lyrata subsp. lyrata] gi|297336010|gb|EFH66427.1| hypothetical protein ARALYDRAFT_471845 [Arabidopsis lyrata subsp. lyrata] Length = 235 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEG+ISSKNIEIG IG++K+F+VLTP+EI+DYL EVE Sbjct: 192 ILTLKEGFEGEISSKNIEIGKIGADKVFRVLTPAEIDDYLAEVE 235 >ref|XP_002889236.1| hypothetical protein ARALYDRAFT_895825 [Arabidopsis lyrata subsp. lyrata] gi|297335077|gb|EFH65495.1| hypothetical protein ARALYDRAFT_895825 [Arabidopsis lyrata subsp. lyrata] Length = 235 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEG+ISSKNIEIG IG++K+F+VLTP+EI+DYL EVE Sbjct: 192 ILTLKEGFEGEISSKNIEIGKIGADKVFRVLTPAEIDDYLAEVE 235 >ref|XP_002675300.1| predicted protein [Naegleria gruberi] gi|284088895|gb|EFC42556.1| predicted protein [Naegleria gruberi] Length = 233 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/44 (72%), Positives = 43/44 (97%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGF+GQI+SKNIEIG++G +K+F+VLTP+E++DYL+EVE Sbjct: 190 ILTLKEGFDGQINSKNIEIGIVGKDKLFRVLTPAEVKDYLEEVE 233 >gb|AAK95291.1|AF410305_1 At1g16470/F3O9_27 [Arabidopsis thaliana] gi|23308239|gb|AAN18089.1| At1g16470/F3O9_27 [Arabidopsis thaliana] Length = 99 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEG+ISSKNIEIG IG++K+F+VLTP+EI+DYL EVE Sbjct: 56 ILTLKEGFEGEISSKNIEIGKIGADKVFRVLTPAEIDDYLAEVE 99 >ref|XP_002278126.1| PREDICTED: proteasome subunit alpha type-2-B [Vitis vinifera] gi|297737956|emb|CBI27157.3| unnamed protein product [Vitis vinifera] Length = 235 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQISSKNIEIG+IG+++ F+VLTP+EI+DYL EVE Sbjct: 192 ILTLKEGFEGQISSKNIEIGIIGTDRKFRVLTPAEIDDYLAEVE 235 >ref|XP_006584582.1| PREDICTED: uncharacterized protein LOC100799108 isoform X2 [Glycine max] Length = 283 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQIS KNIEIG+IG++K F+VLTP+EI+DYL EVE Sbjct: 240 ILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLAEVE 283 >ref|XP_006584581.1| PREDICTED: uncharacterized protein LOC100799108 isoform X1 [Glycine max] Length = 287 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQIS KNIEIG+IG++K F+VLTP+EI+DYL EVE Sbjct: 244 ILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLAEVE 287 >ref|XP_006576205.1| PREDICTED: uncharacterized protein LOC100527630 isoform X3 [Glycine max] Length = 157 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQIS KNIEIG+IG++K F+VLTP+EI+DYL EVE Sbjct: 114 ILTLKEGFEGQISGKNIEIGIIGADKNFRVLTPAEIDDYLAEVE 157 >ref|XP_006576203.1| PREDICTED: uncharacterized protein LOC100527630 isoform X1 [Glycine max] gi|571443510|ref|XP_006576204.1| PREDICTED: uncharacterized protein LOC100527630 isoform X2 [Glycine max] Length = 235 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQIS KNIEIG+IG++K F+VLTP+EI+DYL EVE Sbjct: 192 ILTLKEGFEGQISGKNIEIGIIGADKNFRVLTPAEIDDYLAEVE 235 >gb|ESW21300.1| hypothetical protein PHAVU_005G059300g [Phaseolus vulgaris] Length = 235 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -3 Query: 457 ILTLKEGFEGQISSKNIEIGVIGSNKIFKVLTPSEIEDYLQEVE 326 ILTLKEGFEGQIS KNIEIG+IG++K F+VLTP+EI+DYL EVE Sbjct: 192 ILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLAEVE 235