BLASTX nr result
ID: Rehmannia22_contig00018793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00018793 (551 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64663.1| hypothetical protein M569_10117 [Genlisea aurea] 64 2e-08 ref|XP_006341665.1| PREDICTED: plastidic ATP/ADP-transporter-lik... 61 2e-07 ref|NP_001274794.1| plastidic ATP/ADP-transporter [Solanum tuber... 56 7e-06 >gb|EPS64663.1| hypothetical protein M569_10117 [Genlisea aurea] Length = 631 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -2 Query: 169 MQAVLQSKGLLSLPSNPKTR---AFIAKPSCDL-RYRFNPISKPRTLNKSLLSLDGFSKF 2 MQAVLQS+G+LSLPSNPKT F+++PSC L R+RF+P SKP + S+DGFSKF Sbjct: 1 MQAVLQSRGILSLPSNPKTNRGGGFVSQPSCGLRRFRFDPPSKPLLSS----SVDGFSKF 56 >ref|XP_006341665.1| PREDICTED: plastidic ATP/ADP-transporter-like [Solanum tuberosum] Length = 626 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/55 (60%), Positives = 39/55 (70%) Frame = -2 Query: 169 MQAVLQSKGLLSLPSNPKTRAFIAKPSCDLRYRFNPISKPRTLNKSLLSLDGFSK 5 M+AVLQ+KGLLSLPS PK RAF P LR+RFN + KP++L LS DGF K Sbjct: 1 MEAVLQTKGLLSLPSKPKIRAFYPIPQGGLRHRFNSL-KPKSLEGLSLSSDGFQK 54 >ref|NP_001274794.1| plastidic ATP/ADP-transporter [Solanum tuberosum] gi|6226239|sp|O24381.2|TLC1_SOLTU RecName: Full=Plastidic ATP/ADP-transporter gi|4138583|emb|CAA71785.1| plastidic ATP/ADP-transporter [Solanum tuberosum] Length = 631 Score = 55.8 bits (133), Expect = 7e-06 Identities = 31/57 (54%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = -2 Query: 169 MQAVLQSKGLLSLPSNPKTRAFIAKPSCDLRYRFNPIS--KPRTLNKSLLSLDGFSK 5 M+ VLQ++GLLSLPS PK +AF P LR RFN +S KP LN LS +GF K Sbjct: 1 MEGVLQTRGLLSLPSKPKIKAFYPLPQGGLRNRFNSLSSLKPNPLNGVSLSSNGFQK 57