BLASTX nr result
ID: Rehmannia22_contig00018580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00018580 (1273 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006856966.1| hypothetical protein AMTR_s00832p00008210, p... 41 6e-06 >ref|XP_006856966.1| hypothetical protein AMTR_s00832p00008210, partial [Amborella trichopoda] gi|548861002|gb|ERN18433.1| hypothetical protein AMTR_s00832p00008210, partial [Amborella trichopoda] Length = 731 Score = 40.8 bits (94), Expect(2) = 6e-06 Identities = 18/42 (42%), Positives = 28/42 (66%) Frame = +1 Query: 1051 ERTIYLYNSLKTDDYLKVDAEAVKAYSSLLPRFLSLVAFYGV 1176 +R IYLYNSL++ Y+ EA K +S +LP + S++ F G+ Sbjct: 602 DRRIYLYNSLRSGRYMTAAKEACKPFSVILPYYFSMLDFKGL 643 Score = 37.4 bits (85), Expect(2) = 6e-06 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 947 YIMGYDIACGRPLSEVDHILFPIHCIDMEHWVMGR 1051 YI G I C P VDH++ PI+ +HW+ GR Sbjct: 563 YIQGGKILCATPWHLVDHVVMPINVKLQDHWICGR 597