BLASTX nr result
ID: Rehmannia22_contig00018403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00018403 (425 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589895.1| TNP1 [Medicago truncatula] gi|355478943|gb|A... 60 4e-07 ref|XP_003589878.1| Ubiquitin-like-specific protease [Medicago t... 60 4e-07 >ref|XP_003589895.1| TNP1 [Medicago truncatula] gi|355478943|gb|AES60146.1| TNP1 [Medicago truncatula] Length = 316 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/67 (44%), Positives = 45/67 (67%) Frame = -2 Query: 388 VHHKKLLPGHVKVSVDEIVDGAELLLLPMQTQYHTRVGEVIGSFTQWPMHLVLLGEKDIK 209 +H+KKL PG+VKV +D V+ +LL +P++ VGE IG+F W ++LV L ++ K Sbjct: 82 LHNKKLPPGYVKVRIDVAVERKDLLPIPVEEGDVLTVGEAIGTFVAWELNLVKLVDEHQK 141 Query: 208 LKLKRKD 188 LKLK+ D Sbjct: 142 LKLKKID 148 >ref|XP_003589878.1| Ubiquitin-like-specific protease [Medicago truncatula] gi|355478926|gb|AES60129.1| Ubiquitin-like-specific protease [Medicago truncatula] Length = 420 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/67 (44%), Positives = 45/67 (67%) Frame = -2 Query: 388 VHHKKLLPGHVKVSVDEIVDGAELLLLPMQTQYHTRVGEVIGSFTQWPMHLVLLGEKDIK 209 +H+KKL PG+VKV +D V+ +LL +P++ VGE IG+F W ++LV L ++ K Sbjct: 98 LHNKKLPPGYVKVRIDVAVERKDLLPIPVEEGDVLTVGEAIGTFVAWELNLVKLVDEHQK 157 Query: 208 LKLKRKD 188 LKLK+ D Sbjct: 158 LKLKKID 164