BLASTX nr result
ID: Rehmannia22_contig00018328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00018328 (1647 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361084.1| PREDICTED: OTU domain-containing protein 5-l... 60 4e-06 ref|XP_006384751.1| hypothetical protein POPTR_0004s20770g [Popu... 60 4e-06 ref|XP_006384750.1| hypothetical protein POPTR_0004s20770g [Popu... 60 4e-06 gb|EPS67745.1| hypothetical protein M569_07026, partial [Genlise... 60 4e-06 ref|XP_004291697.1| PREDICTED: uncharacterized protein LOC101291... 60 4e-06 ref|XP_004251073.1| PREDICTED: uncharacterized protein LOC101264... 60 4e-06 ref|XP_004241324.1| PREDICTED: uncharacterized protein LOC101253... 60 4e-06 ref|XP_002523840.1| expressed protein, putative [Ricinus communi... 60 4e-06 ref|XP_002313608.1| OTU-like cysteine protease family protein [P... 60 4e-06 ref|XP_002328229.1| predicted protein [Populus trichocarpa] 60 4e-06 ref|XP_006487915.1| PREDICTED: OTU domain-containing protein 5-B... 59 6e-06 gb|ESW04456.1| hypothetical protein PHAVU_011G096000g [Phaseolus... 59 8e-06 ref|XP_006851481.1| hypothetical protein AMTR_s00040p00136460 [A... 59 8e-06 ref|XP_003539838.1| PREDICTED: OTU domain-containing protein 5-l... 59 8e-06 ref|XP_003538105.1| PREDICTED: OTU domain-containing protein 5-l... 59 8e-06 >ref|XP_006361084.1| PREDICTED: OTU domain-containing protein 5-like [Solanum tuberosum] Length = 537 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKILSRKLS 1538 ERDHFSQFITEGFTSYCKRKRRDKV+ + + LS Sbjct: 286 ERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALS 321 >ref|XP_006384751.1| hypothetical protein POPTR_0004s20770g [Populus trichocarpa] gi|566167651|ref|XP_006384752.1| hypothetical protein POPTR_0004s20770g [Populus trichocarpa] gi|550341519|gb|ERP62548.1| hypothetical protein POPTR_0004s20770g [Populus trichocarpa] gi|550341520|gb|ERP62549.1| hypothetical protein POPTR_0004s20770g [Populus trichocarpa] Length = 535 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKILSRKLS 1538 ERDHFSQFITEGFTSYCKRKRRDKV+ + + LS Sbjct: 283 ERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALS 318 >ref|XP_006384750.1| hypothetical protein POPTR_0004s20770g [Populus trichocarpa] gi|550341518|gb|ERP62547.1| hypothetical protein POPTR_0004s20770g [Populus trichocarpa] Length = 456 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKILSRKLS 1538 ERDHFSQFITEGFTSYCKRKRRDKV+ + + LS Sbjct: 283 ERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALS 318 >gb|EPS67745.1| hypothetical protein M569_07026, partial [Genlisea aurea] Length = 372 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKILSRKLS 1538 ERDHFSQFITEGFTSYCKRKRRDKV+ + + LS Sbjct: 141 ERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALS 176 >ref|XP_004291697.1| PREDICTED: uncharacterized protein LOC101291693 [Fragaria vesca subsp. vesca] Length = 535 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKILSRKLS 1538 ERDHFSQFITEGFTSYCKRKRRDKV+ + + LS Sbjct: 287 ERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALS 322 >ref|XP_004251073.1| PREDICTED: uncharacterized protein LOC101264788 isoform 1 [Solanum lycopersicum] gi|460411348|ref|XP_004251074.1| PREDICTED: uncharacterized protein LOC101264788 isoform 2 [Solanum lycopersicum] Length = 524 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKILSRKLS 1538 ERDHFSQFITEGFTSYCKRKRRDKV+ + + LS Sbjct: 280 ERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALS 315 >ref|XP_004241324.1| PREDICTED: uncharacterized protein LOC101253195 [Solanum lycopersicum] Length = 537 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKILSRKLS 1538 ERDHFSQFITEGFTSYCKRKRRDKV+ + + LS Sbjct: 286 ERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALS 321 >ref|XP_002523840.1| expressed protein, putative [Ricinus communis] gi|223536928|gb|EEF38566.1| expressed protein, putative [Ricinus communis] Length = 534 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKILSRKLS 1538 ERDHFSQFITEGFTSYCKRKRRDKV+ + + LS Sbjct: 284 ERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALS 319 >ref|XP_002313608.1| OTU-like cysteine protease family protein [Populus trichocarpa] gi|222850016|gb|EEE87563.1| OTU-like cysteine protease family protein [Populus trichocarpa] Length = 534 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKILSRKLS 1538 ERDHFSQFITEGFTSYCKRKRRDKV+ + + LS Sbjct: 283 ERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALS 318 >ref|XP_002328229.1| predicted protein [Populus trichocarpa] Length = 289 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKILSRKLS 1538 ERDHFSQFITEGFTSYCKRKRRDKV+ + + LS Sbjct: 37 ERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALS 72 >ref|XP_006487915.1| PREDICTED: OTU domain-containing protein 5-B-like isoform X1 [Citrus sinensis] gi|568869402|ref|XP_006487916.1| PREDICTED: OTU domain-containing protein 5-B-like isoform X2 [Citrus sinensis] Length = 535 Score = 58.9 bits (141), Expect = 6e-06 Identities = 31/55 (56%), Positives = 35/55 (63%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKILSRKLS*CNFRNTFLMAVFVTQEAI 1481 ERDHFSQFITEGFTSYCKRKRRDKV+ + + L C N + T E I Sbjct: 285 ERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQAL--CEMYNRPIHIYSYTTEPI 337 >gb|ESW04456.1| hypothetical protein PHAVU_011G096000g [Phaseolus vulgaris] Length = 513 Score = 58.5 bits (140), Expect = 8e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKI 1556 ERDHFSQFITEGFTSYCKRKRRDKV+ + Sbjct: 268 ERDHFSQFITEGFTSYCKRKRRDKVYGNNV 297 >ref|XP_006851481.1| hypothetical protein AMTR_s00040p00136460 [Amborella trichopoda] gi|548855175|gb|ERN13062.1| hypothetical protein AMTR_s00040p00136460 [Amborella trichopoda] Length = 556 Score = 58.5 bits (140), Expect = 8e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKI 1556 ERDHFSQFITEGFTSYCKRKRRDKV+ + Sbjct: 298 ERDHFSQFITEGFTSYCKRKRRDKVYGNNV 327 >ref|XP_003539838.1| PREDICTED: OTU domain-containing protein 5-like isoform X1 [Glycine max] gi|571492760|ref|XP_006592338.1| PREDICTED: OTU domain-containing protein 5-like isoform X2 [Glycine max] Length = 519 Score = 58.5 bits (140), Expect = 8e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKI 1556 ERDHFSQFITEGFTSYCKRKRRDKV+ + Sbjct: 271 ERDHFSQFITEGFTSYCKRKRRDKVYGNNV 300 >ref|XP_003538105.1| PREDICTED: OTU domain-containing protein 5-like isoform X1 [Glycine max] gi|571488924|ref|XP_006591068.1| PREDICTED: OTU domain-containing protein 5-like isoform X2 [Glycine max] gi|571488926|ref|XP_006591069.1| PREDICTED: OTU domain-containing protein 5-like isoform X3 [Glycine max] gi|571488928|ref|XP_006591070.1| PREDICTED: OTU domain-containing protein 5-like isoform X4 [Glycine max] Length = 520 Score = 58.5 bits (140), Expect = 8e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 1645 ERDHFSQFITEGFTSYCKRKRRDKVHDTKI 1556 ERDHFSQFITEGFTSYCKRKRRDKV+ + Sbjct: 272 ERDHFSQFITEGFTSYCKRKRRDKVYGNNV 301