BLASTX nr result
ID: Rehmannia22_contig00018222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00018222 (832 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB66604.1| hypothetical protein L484_024900 [Morus notabilis] 62 3e-07 >gb|EXB66604.1| hypothetical protein L484_024900 [Morus notabilis] Length = 147 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/66 (46%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = +3 Query: 636 PFSEEVMADELLASYRALSFE-YDGTTDPWDHLCRFENAALLHRFTDGVMCRVFPTTLTK 812 PF+EE+MA L YR+ S YDG DP DHL + LLH +T+ +MCR F LT Sbjct: 42 PFTEEIMAPPLPDKYRSPSIPPYDGRGDPDDHLEMYTGHMLLHGYTEEIMCRAFRNHLTD 101 Query: 813 SAQQWF 830 S ++WF Sbjct: 102 STRRWF 107