BLASTX nr result
ID: Rehmannia22_contig00018007
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00018007 (310 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519842.1| pentatricopeptide repeat-containing protein,... 80 3e-13 gb|EXB99769.1| hypothetical protein L484_023300 [Morus notabilis] 79 5e-13 gb|EMJ11528.1| hypothetical protein PRUPE_ppa002049mg [Prunus pe... 79 5e-13 ref|XP_006352838.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 ref|XP_004245879.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 gb|EOY24047.1| Pentatricopeptide (PPR) repeat-containing protein... 77 3e-12 ref|XP_006485434.1| PREDICTED: pentatricopeptide repeat-containi... 75 9e-12 ref|XP_006436751.1| hypothetical protein CICLE_v10033739mg [Citr... 75 9e-12 ref|XP_006385629.1| hypothetical protein POPTR_0003s08800g [Popu... 74 3e-11 ref|XP_004148730.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_004300258.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_002278451.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_003608637.1| Pentatricopeptide repeat-containing protein ... 68 1e-09 ref|XP_006600892.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_003549976.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_003524052.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_004512663.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 ref|XP_002863397.1| pentatricopeptide repeat-containing protein ... 65 9e-09 gb|ESW27757.1| hypothetical protein PHAVU_003G229500g [Phaseolus... 64 2e-08 ref|NP_199470.1| pentatricopeptide repeat-containing protein [Ar... 64 2e-08 >ref|XP_002519842.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540888|gb|EEF42446.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 677 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/51 (72%), Positives = 45/51 (88%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMTT 156 FSQGL NAFASHVEKLA PFR+SE K+G FVATREDLV+W QS++P ++T+ Sbjct: 627 FSQGLANAFASHVEKLAAPFRQSEEKAGCFVATREDLVTWAQSRSPSLITS 677 >gb|EXB99769.1| hypothetical protein L484_023300 [Morus notabilis] Length = 710 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMT 159 FSQGL N+FASH EKLA PFR+SE K+G FVATREDLVSW QS+AP +T Sbjct: 660 FSQGLANSFASHAEKLAAPFRQSEEKAGCFVATREDLVSWAQSRAPTAVT 709 >gb|EMJ11528.1| hypothetical protein PRUPE_ppa002049mg [Prunus persica] Length = 724 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMTTA 153 FSQGL ++FASHVEKLA PFR+SE K+G FVATREDLVSWVQS+AP TA Sbjct: 673 FSQGLAHSFASHVEKLAAPFRKSEEKAGRFVATREDLVSWVQSQAPSTAITA 724 >ref|XP_006352838.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Solanum tuberosum] Length = 711 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKA 174 FSQGL NAFASHVEKLA PF++SE K+GFF+ATRED+V WVQSKA Sbjct: 663 FSQGLANAFASHVEKLAAPFKQSEEKAGFFIATREDVVLWVQSKA 707 >ref|XP_004245879.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Solanum lycopersicum] Length = 711 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKA 174 FSQGL NAFASHVEK A PF++SE K+GFF+ATRED+VSWV SKA Sbjct: 663 FSQGLANAFASHVEKFAAPFKQSEEKAGFFIATREDVVSWVHSKA 707 >gb|EOY24047.1| Pentatricopeptide (PPR) repeat-containing protein [Theobroma cacao] Length = 711 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMTTA 153 FSQGL NAFASH++KLAVPFR+SE K+G FVATREDLV W+QS+ P TA Sbjct: 660 FSQGLSNAFASHLKKLAVPFRQSEEKAGCFVATREDLVLWLQSRIPSPAVTA 711 >ref|XP_006485434.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Citrus sinensis] Length = 730 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSK 177 FSQGL AFASHV KLA PFR+SEGK+G FVATREDLVSWVQ++ Sbjct: 681 FSQGLATAFASHVNKLAAPFRQSEGKAGCFVATREDLVSWVQAR 724 >ref|XP_006436751.1| hypothetical protein CICLE_v10033739mg [Citrus clementina] gi|557538947|gb|ESR49991.1| hypothetical protein CICLE_v10033739mg [Citrus clementina] Length = 692 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSK 177 FSQGL AFASHV KLA PFR+SEGK+G FVATREDLVSWVQ++ Sbjct: 643 FSQGLATAFASHVNKLAAPFRQSEGKAGCFVATREDLVSWVQAR 686 >ref|XP_006385629.1| hypothetical protein POPTR_0003s08800g [Populus trichocarpa] gi|550342759|gb|ERP63426.1| hypothetical protein POPTR_0003s08800g [Populus trichocarpa] Length = 721 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMT 159 FSQGL N+F SHV+KLA PFR+SE ++G FVATREDLV+WVQS+ P +T Sbjct: 667 FSQGLANSFDSHVKKLAAPFRQSEERAGHFVATREDLVTWVQSRIPSSVT 716 >ref|XP_004148730.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Cucumis sativus] gi|449521148|ref|XP_004167592.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Cucumis sativus] Length = 710 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMTTA 153 FSQGL N+FASHV+KLA PF+ E ++G+FVATREDLV+WV S+ P V TA Sbjct: 659 FSQGLANSFASHVDKLAAPFQLREDRAGWFVATREDLVTWVHSRVPSVAATA 710 >ref|XP_004300258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 716 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKA 174 FSQGL ++F SHV+KLA PFR+SE K+G FVATREDLVSWVQS+A Sbjct: 667 FSQGLAHSFGSHVKKLAAPFRQSEEKAGCFVATREDLVSWVQSQA 711 >ref|XP_002278451.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic [Vitis vinifera] Length = 723 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSK 177 FSQGL +AFASHV+KLA PF +SE K+G FVATREDLVSWVQS+ Sbjct: 672 FSQGLASAFASHVKKLAAPFTQSEEKAGCFVATREDLVSWVQSR 715 >ref|XP_003608637.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355509692|gb|AES90834.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 715 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAP 171 F+QGL +FASH+ KLA PFR+SE K G F+AT+EDL+SWVQS +P Sbjct: 664 FAQGLNISFASHLRKLAAPFRQSEDKVGCFIATKEDLISWVQSNSP 709 >ref|XP_006600892.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like isoform X2 [Glycine max] Length = 655 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMT 159 F+QGL +FASH+ KLA PF++SE K G F+A+REDLVSWVQSK+ T Sbjct: 604 FAQGLNISFASHLRKLAAPFKQSEEKIGCFIASREDLVSWVQSKSTAAAT 653 >ref|XP_003549976.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like isoform X1 [Glycine max] Length = 714 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMT 159 F+QGL +FASH+ KLA PF++SE K G F+A+REDLVSWVQSK+ T Sbjct: 663 FAQGLNISFASHLRKLAAPFKQSEEKIGCFIASREDLVSWVQSKSTAAAT 712 >ref|XP_003524052.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Glycine max] Length = 712 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMT 159 F+QGL +FASH+ KLA PF++SE K G F+A+REDLVSWVQSK+ T Sbjct: 663 FAQGLNISFASHLRKLAAPFKQSEEKVGCFIASREDLVSWVQSKSTAAAT 712 >ref|XP_004512663.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Cicer arietinum] Length = 132 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMTTA 153 FSQGL +FASH+ KLA PFR+SE + G F+ATREDLVSWVQ L + A Sbjct: 80 FSQGLNISFASHLRKLAAPFRQSEDQVGCFIATREDLVSWVQQSNSLSSSIA 131 >ref|XP_002863397.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297309232|gb|EFH39656.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 711 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/51 (56%), Positives = 44/51 (86%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMTT 156 FSQGL N+FA H+++L+ PFR+S+ ++G FVAT+EDLVSW++SK P ++T+ Sbjct: 660 FSQGLANSFALHLQQLSAPFRQSD-RAGIFVATKEDLVSWLESKFPPLVTS 709 >gb|ESW27757.1| hypothetical protein PHAVU_003G229500g [Phaseolus vulgaris] Length = 711 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMT 159 F+QGL +FASH+ KLAVPF +S+ K G F ATREDLVSWVQS + T Sbjct: 660 FAQGLNISFASHLRKLAVPFTQSQEKIGCFTATREDLVSWVQSNSTAAAT 709 >ref|NP_199470.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180372|sp|Q9LS25.1|PP420_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g46580, chloroplastic; Flags: Precursor gi|8885599|dbj|BAA97529.1| unnamed protein product [Arabidopsis thaliana] gi|332008017|gb|AED95400.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 711 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/51 (56%), Positives = 43/51 (84%) Frame = -3 Query: 308 FSQGLGNAFASHVEKLAVPFRESEGKSGFFVATREDLVSWVQSKAPLVMTT 156 FSQGL N+FA H+++L+ PFR+S+ + G FVAT+EDLVSW++SK P ++T+ Sbjct: 660 FSQGLANSFALHLQQLSAPFRQSD-RPGIFVATKEDLVSWLESKFPPLVTS 709