BLASTX nr result
ID: Rehmannia22_contig00017773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00017773 (351 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC19138.1| Tripeptidyl-peptidase 2 [Morus notabilis] 61 2e-07 ref|XP_006353291.1| PREDICTED: tripeptidyl-peptidase 2-like [Sol... 61 2e-07 gb|EMJ21502.1| hypothetical protein PRUPE_ppa000308mg [Prunus pe... 61 2e-07 ref|XP_004234455.1| PREDICTED: tripeptidyl-peptidase 2-like [Sol... 61 2e-07 ref|XP_004171962.1| PREDICTED: LOW QUALITY PROTEIN: tripeptidyl-... 61 2e-07 ref|XP_004152382.1| PREDICTED: tripeptidyl-peptidase 2-like [Cuc... 61 2e-07 ref|XP_003592276.1| Tripeptidyl-peptidase [Medicago truncatula] ... 61 2e-07 gb|ADN34295.1| tripeptidyl peptidase II; TPP2 [Cucumis melo subs... 61 2e-07 ref|XP_002513693.1| tripeptidyl peptidase II, putative [Ricinus ... 61 2e-07 ref|XP_002322477.1| subtilase family protein [Populus trichocarp... 61 2e-07 ref|XP_002318216.1| hypothetical protein POPTR_0012s13100g [Popu... 61 2e-07 ref|XP_006490404.1| PREDICTED: tripeptidyl-peptidase 2-like [Cit... 60 2e-07 ref|XP_006421940.1| hypothetical protein CICLE_v10004167mg [Citr... 60 2e-07 ref|XP_006421939.1| hypothetical protein CICLE_v10004167mg [Citr... 60 2e-07 ref|NP_001047661.1| Os02g0664300 [Oryza sativa Japonica Group] g... 60 2e-07 gb|AFW72696.1| hypothetical protein ZEAMMB73_491027 [Zea mays] 60 2e-07 ref|XP_003572791.1| PREDICTED: tripeptidyl-peptidase 2 [Brachypo... 60 2e-07 ref|XP_002454514.1| hypothetical protein SORBIDRAFT_04g032510 [S... 60 2e-07 gb|EEE57528.1| hypothetical protein OsJ_07840 [Oryza sativa Japo... 60 2e-07 gb|EEC73743.1| hypothetical protein OsI_08378 [Oryza sativa Indi... 60 2e-07 >gb|EXC19138.1| Tripeptidyl-peptidase 2 [Morus notabilis] Length = 1389 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRFVDL Sbjct: 413 IAAVEHKCDLINMSYGEPTLLPDYGRFVDL 442 >ref|XP_006353291.1| PREDICTED: tripeptidyl-peptidase 2-like [Solanum tuberosum] Length = 1326 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRFVDL Sbjct: 376 IAAVEHKCDLINMSYGEPTLLPDYGRFVDL 405 >gb|EMJ21502.1| hypothetical protein PRUPE_ppa000308mg [Prunus persica] Length = 1302 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRFVDL Sbjct: 341 IAAVEHKCDLINMSYGEPTLLPDYGRFVDL 370 >ref|XP_004234455.1| PREDICTED: tripeptidyl-peptidase 2-like [Solanum lycopersicum] Length = 862 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRFVDL Sbjct: 180 IAAVEHKCDLINMSYGEPTLLPDYGRFVDL 209 >ref|XP_004171962.1| PREDICTED: LOW QUALITY PROTEIN: tripeptidyl-peptidase 2-like, partial [Cucumis sativus] Length = 790 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRFVDL Sbjct: 228 IAAVEHKCDLINMSYGEPTLLPDYGRFVDL 257 >ref|XP_004152382.1| PREDICTED: tripeptidyl-peptidase 2-like [Cucumis sativus] Length = 1305 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRFVDL Sbjct: 338 IAAVEHKCDLINMSYGEPTLLPDYGRFVDL 367 >ref|XP_003592276.1| Tripeptidyl-peptidase [Medicago truncatula] gi|355481324|gb|AES62527.1| Tripeptidyl-peptidase [Medicago truncatula] Length = 1385 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRFVDL Sbjct: 395 IAAVEHKCDLINMSYGEPTLLPDYGRFVDL 424 >gb|ADN34295.1| tripeptidyl peptidase II; TPP2 [Cucumis melo subsp. melo] Length = 1139 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRFVDL Sbjct: 388 IAAVEHKCDLINMSYGEPTLLPDYGRFVDL 417 >ref|XP_002513693.1| tripeptidyl peptidase II, putative [Ricinus communis] gi|223547601|gb|EEF49096.1| tripeptidyl peptidase II, putative [Ricinus communis] Length = 1301 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRFVDL Sbjct: 343 IAAVEHKCDLINMSYGEPTLLPDYGRFVDL 372 >ref|XP_002322477.1| subtilase family protein [Populus trichocarpa] gi|222869473|gb|EEF06604.1| subtilase family protein [Populus trichocarpa] Length = 1339 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRFVDL Sbjct: 344 IAAVEHKCDLINMSYGEPTLLPDYGRFVDL 373 >ref|XP_002318216.1| hypothetical protein POPTR_0012s13100g [Populus trichocarpa] gi|566198253|ref|XP_006377066.1| subtilase family protein [Populus trichocarpa] gi|222858889|gb|EEE96436.1| hypothetical protein POPTR_0012s13100g [Populus trichocarpa] gi|550327023|gb|ERP54863.1| subtilase family protein [Populus trichocarpa] Length = 1299 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRFVDL Sbjct: 343 IAAVEHKCDLINMSYGEPTLLPDYGRFVDL 372 >ref|XP_006490404.1| PREDICTED: tripeptidyl-peptidase 2-like [Citrus sinensis] Length = 1373 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRF+DL Sbjct: 403 IAAVEHKCDLINMSYGEPTLLPDYGRFIDL 432 >ref|XP_006421940.1| hypothetical protein CICLE_v10004167mg [Citrus clementina] gi|557523813|gb|ESR35180.1| hypothetical protein CICLE_v10004167mg [Citrus clementina] Length = 948 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRF+DL Sbjct: 342 IAAVEHKCDLINMSYGEPTLLPDYGRFIDL 371 >ref|XP_006421939.1| hypothetical protein CICLE_v10004167mg [Citrus clementina] gi|557523812|gb|ESR35179.1| hypothetical protein CICLE_v10004167mg [Citrus clementina] Length = 1312 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRF+DL Sbjct: 342 IAAVEHKCDLINMSYGEPTLLPDYGRFIDL 371 >ref|NP_001047661.1| Os02g0664300 [Oryza sativa Japonica Group] gi|50251356|dbj|BAD28383.1| putative tripeptidyl peptidase II [Oryza sativa Japonica Group] gi|113537192|dbj|BAF09575.1| Os02g0664300 [Oryza sativa Japonica Group] Length = 1359 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRF+DL Sbjct: 404 IAAVEHKCDLINMSYGEPTLLPDYGRFIDL 433 >gb|AFW72696.1| hypothetical protein ZEAMMB73_491027 [Zea mays] Length = 704 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRF+DL Sbjct: 374 IAAVEHKCDLINMSYGEPTLLPDYGRFIDL 403 >ref|XP_003572791.1| PREDICTED: tripeptidyl-peptidase 2 [Brachypodium distachyon] Length = 1356 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRF+DL Sbjct: 400 IAAVEHKCDLINMSYGEPTLLPDYGRFIDL 429 >ref|XP_002454514.1| hypothetical protein SORBIDRAFT_04g032510 [Sorghum bicolor] gi|241934345|gb|EES07490.1| hypothetical protein SORBIDRAFT_04g032510 [Sorghum bicolor] Length = 1353 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRF+DL Sbjct: 400 IAAVEHKCDLINMSYGEPTLLPDYGRFIDL 429 >gb|EEE57528.1| hypothetical protein OsJ_07840 [Oryza sativa Japonica Group] Length = 1295 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRF+DL Sbjct: 340 IAAVEHKCDLINMSYGEPTLLPDYGRFIDL 369 >gb|EEC73743.1| hypothetical protein OsI_08378 [Oryza sativa Indica Group] Length = 1359 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 262 VIVVHHKCDLINMSYGEPTLLPDYGRFVDL 351 + V HKCDLINMSYGEPTLLPDYGRF+DL Sbjct: 404 IAAVEHKCDLINMSYGEPTLLPDYGRFIDL 433