BLASTX nr result
ID: Rehmannia22_contig00017679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00017679 (347 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006366416.1| PREDICTED: transcription factor bHLH143-like... 56 6e-06 >ref|XP_006366416.1| PREDICTED: transcription factor bHLH143-like [Solanum tuberosum] Length = 362 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/74 (40%), Positives = 38/74 (51%), Gaps = 15/74 (20%) Frame = +3 Query: 162 AREPNYSQNWLYCMPHFHKAFPPAF--------------DFGQQKSPITAPTPAPKRFLV 299 A +P + NWLYC+P H+ F P + G + P A KRFLV Sbjct: 65 ASQPTEAHNWLYCLPQLHQGFAPVLSTISKEKFAPQSVDNSGVNEEANAGPGSAQKRFLV 124 Query: 300 FDQSGDRTT-MYSS 338 FDQSGD+TT +YSS Sbjct: 125 FDQSGDQTTLLYSS 138