BLASTX nr result
ID: Rehmannia22_contig00016801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00016801 (319 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64576.1| hypothetical protein M569_10205, partial [Genlise... 56 6e-06 ref|XP_006380178.1| hypothetical protein POPTR_0008s22640g [Popu... 55 7e-06 gb|EOY06470.1| Sucrose nonfermenting 4 [Theobroma cacao] 55 7e-06 ref|XP_002330362.1| predicted protein [Populus trichocarpa] 55 7e-06 ref|XP_002314455.2| hypothetical protein POPTR_0010s02420g [Popu... 55 9e-06 >gb|EPS64576.1| hypothetical protein M569_10205, partial [Genlisea aurea] Length = 254 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 120 GNLLAPLWDFSNGKFVGVLSALDFVLIMKELG 25 G +APLWDFS GKFVGVLSA DF+LIMKELG Sbjct: 131 GISMAPLWDFSKGKFVGVLSAHDFILIMKELG 162 >ref|XP_006380178.1| hypothetical protein POPTR_0008s22640g [Populus trichocarpa] gi|550333699|gb|ERP57975.1| hypothetical protein POPTR_0008s22640g [Populus trichocarpa] Length = 480 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -2 Query: 129 FFPGNLLAPLWDFSNGKFVGVLSALDFVLIMKELG 25 F G +APLWDFS G+FVGVLSALDF+LI++ELG Sbjct: 184 FEQGISMAPLWDFSRGQFVGVLSALDFILILRELG 218 >gb|EOY06470.1| Sucrose nonfermenting 4 [Theobroma cacao] Length = 489 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -2 Query: 111 LAPLWDFSNGKFVGVLSALDFVLIMKELG 25 +APLWDFS GKFVG+LSALDF+LI++ELG Sbjct: 200 MAPLWDFSKGKFVGILSALDFILILRELG 228 >ref|XP_002330362.1| predicted protein [Populus trichocarpa] Length = 464 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -2 Query: 129 FFPGNLLAPLWDFSNGKFVGVLSALDFVLIMKELG 25 F G +APLWDFS G+FVGVLSALDF+LI++ELG Sbjct: 168 FEQGISMAPLWDFSRGQFVGVLSALDFILILRELG 202 >ref|XP_002314455.2| hypothetical protein POPTR_0010s02420g [Populus trichocarpa] gi|550328943|gb|EEF00626.2| hypothetical protein POPTR_0010s02420g [Populus trichocarpa] Length = 463 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -2 Query: 129 FFPGNLLAPLWDFSNGKFVGVLSALDFVLIMKELG 25 F G +APLWDFS G+FVGVLSALDF+LI++ELG Sbjct: 167 FEQGIPMAPLWDFSRGQFVGVLSALDFILILRELG 201