BLASTX nr result
ID: Rehmannia22_contig00016641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00016641 (621 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHJ25927.1| importin subunit alpha-1 [Senecio scandens] 73 6e-11 gb|EPS62504.1| hypothetical protein M569_12283, partial [Genlise... 70 5e-10 gb|ABM05487.1| Impa1 [Nicotiana benthamiana] 67 3e-09 ref|XP_003546338.1| PREDICTED: importin subunit alpha-1-like iso... 67 5e-09 ref|XP_003550530.1| PREDICTED: importin subunit alpha-1-like [Gl... 66 9e-09 ref|XP_003533220.1| PREDICTED: importin subunit alpha-1-like iso... 65 1e-08 ref|XP_004487798.1| PREDICTED: importin subunit alpha-1-like [Ci... 65 2e-08 ref|XP_003594812.1| Importin subunit alpha-1 [Medicago truncatul... 65 2e-08 gb|EXB55756.1| Importin subunit alpha-1 [Morus notabilis] 64 3e-08 gb|EMJ23688.1| hypothetical protein PRUPE_ppa004118mg [Prunus pe... 64 5e-08 ref|XP_006345634.1| PREDICTED: importin subunit alpha-1-like [So... 63 6e-08 ref|XP_002275593.1| PREDICTED: importin subunit alpha-1 [Vitis v... 63 6e-08 ref|XP_006488879.1| PREDICTED: importin subunit alpha-1-like [Ci... 61 3e-07 gb|ABM05488.1| Impa2 [Nicotiana benthamiana] 60 4e-07 ref|XP_004244944.1| PREDICTED: importin subunit alpha-1-like [So... 60 5e-07 gb|ESW10960.1| hypothetical protein PHAVU_009G253500g [Phaseolus... 59 9e-07 ref|XP_004295110.1| PREDICTED: importin subunit alpha-1-like [Fr... 59 9e-07 ref|XP_002512485.1| importin alpha, putative [Ricinus communis] ... 57 3e-06 ref|XP_002334370.1| predicted protein [Populus trichocarpa] 57 3e-06 ref|XP_002315463.1| predicted protein [Populus trichocarpa] 57 3e-06 >gb|AHJ25927.1| importin subunit alpha-1 [Senecio scandens] Length = 529 Score = 73.2 bits (178), Expect = 6e-11 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKF 514 YWLEE+DEQLVS D PQ GFNFGGG+LPVPSGGFKF Sbjct: 493 YWLEEEDEQLVSSDGPQAGFNFGGGELPVPSGGFKF 528 >gb|EPS62504.1| hypothetical protein M569_12283, partial [Genlisea aurea] Length = 535 Score = 70.1 bits (170), Expect = 5e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLEEDDEQL SGDA Q GFNFGGGD VPSGGFKF+ Sbjct: 499 YWLEEDDEQLASGDAQQSGFNFGGGDNAVPSGGFKFA 535 >gb|ABM05487.1| Impa1 [Nicotiana benthamiana] Length = 532 Score = 67.4 bits (163), Expect = 3e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLEEDDEQL S DA GFNFGGG+LP+PSGGF FS Sbjct: 495 YWLEEDDEQLPSADAQHSGFNFGGGELPLPSGGFNFS 531 >ref|XP_003546338.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine max] gi|571518596|ref|XP_006597715.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine max] Length = 531 Score = 66.6 bits (161), Expect = 5e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLE+DDE L +GD QPGFNFG DLPVPSGGF FS Sbjct: 495 YWLEDDDETLPAGDGAQPGFNFGNNDLPVPSGGFNFS 531 >ref|XP_003550530.1| PREDICTED: importin subunit alpha-1-like [Glycine max] Length = 530 Score = 65.9 bits (159), Expect = 9e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLEE+DE L SGD QPGFNFG +LPVPSGGF FS Sbjct: 494 YWLEEEDETLPSGDGAQPGFNFGNNELPVPSGGFNFS 530 >ref|XP_003533220.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine max] gi|571476251|ref|XP_006586905.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine max] gi|571476254|ref|XP_006586906.1| PREDICTED: importin subunit alpha-1-like isoform X3 [Glycine max] Length = 531 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLE+DDE L +GD QPGFNFG D+PVPSGGF FS Sbjct: 495 YWLEDDDETLPTGDGAQPGFNFGNNDVPVPSGGFNFS 531 >ref|XP_004487798.1| PREDICTED: importin subunit alpha-1-like [Cicer arietinum] Length = 531 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLE++DE L +GD QPGFNFG DLPVPSGGF FS Sbjct: 495 YWLEDEDETLPAGDGSQPGFNFGSSDLPVPSGGFNFS 531 >ref|XP_003594812.1| Importin subunit alpha-1 [Medicago truncatula] gi|355483860|gb|AES65063.1| Importin subunit alpha-1 [Medicago truncatula] Length = 561 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKF 514 YWLE++DE L GD QPGFNFGG DLPVPSGGF F Sbjct: 525 YWLEDEDETLPPGDGSQPGFNFGGNDLPVPSGGFNF 560 >gb|EXB55756.1| Importin subunit alpha-1 [Morus notabilis] Length = 529 Score = 63.9 bits (154), Expect = 3e-08 Identities = 28/37 (75%), Positives = 28/37 (75%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLEEDDE L GD Q GF FGG DLPVPSGGF FS Sbjct: 493 YWLEEDDETLPPGDGSQSGFRFGGNDLPVPSGGFNFS 529 >gb|EMJ23688.1| hypothetical protein PRUPE_ppa004118mg [Prunus persica] Length = 529 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YW+EEDDE L SGD QPGF+FGG +L VPSGGF FS Sbjct: 493 YWVEEDDETLPSGDGSQPGFHFGGNELQVPSGGFNFS 529 >ref|XP_006345634.1| PREDICTED: importin subunit alpha-1-like [Solanum tuberosum] Length = 529 Score = 63.2 bits (152), Expect = 6e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLEEDDE + GDAPQ GF FGGG++ VPSGGF F+ Sbjct: 493 YWLEEDDETMPPGDAPQQGFQFGGGEVSVPSGGFSFN 529 >ref|XP_002275593.1| PREDICTED: importin subunit alpha-1 [Vitis vinifera] gi|296083287|emb|CBI22923.3| unnamed protein product [Vitis vinifera] Length = 529 Score = 63.2 bits (152), Expect = 6e-08 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLEE+DE L SGD QPGF FGG D+ VPSGGF FS Sbjct: 493 YWLEEEDETLPSGDGSQPGFQFGGNDVSVPSGGFNFS 529 >ref|XP_006488879.1| PREDICTED: importin subunit alpha-1-like [Citrus sinensis] Length = 532 Score = 60.8 bits (146), Expect = 3e-07 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLEEDDE + +GD PQPGF + G ++ VPSGGF FS Sbjct: 496 YWLEEDDETIAAGDGPQPGFPYAGNEVQVPSGGFNFS 532 >gb|ABM05488.1| Impa2 [Nicotiana benthamiana] Length = 529 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKF 514 YWLEE+DE L +GD Q GFNFGG D+ +PSGGFKF Sbjct: 493 YWLEEEDETLPAGDEAQAGFNFGGNDIQLPSGGFKF 528 >ref|XP_004244944.1| PREDICTED: importin subunit alpha-1-like [Solanum lycopersicum] Length = 529 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLEEDDE + GDA Q GF FGGG++ VPSGGF F+ Sbjct: 493 YWLEEDDETMPPGDAAQQGFQFGGGEVSVPSGGFSFN 529 >gb|ESW10960.1| hypothetical protein PHAVU_009G253500g [Phaseolus vulgaris] Length = 529 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLE+DD+ L +GD QPGFNF G +LPVPSGGF FS Sbjct: 494 YWLEDDDDTLPTGDGAQPGFNF-GNELPVPSGGFNFS 529 >ref|XP_004295110.1| PREDICTED: importin subunit alpha-1-like [Fragaria vesca subsp. vesca] Length = 528 Score = 59.3 bits (142), Expect = 9e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKFS 511 YWLE++DE L +GDA QPGFNFGG VP+GGF FS Sbjct: 492 YWLEDEDETLPAGDAAQPGFNFGGNGPQVPTGGFNFS 528 >ref|XP_002512485.1| importin alpha, putative [Ricinus communis] gi|223548446|gb|EEF49937.1| importin alpha, putative [Ricinus communis] Length = 531 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/38 (65%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLP-VPSGGFKFS 511 YWLEE+DE + GDA Q GF FGG D+P +PSGGF FS Sbjct: 494 YWLEEEDETMPPGDASQSGFQFGGSDMPTIPSGGFNFS 531 >ref|XP_002334370.1| predicted protein [Populus trichocarpa] Length = 420 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKF 514 YWLEEDDE L SGD Q GF FGG + VPSGGF F Sbjct: 385 YWLEEDDETLPSGDGAQQGFQFGGNGVQVPSGGFNF 420 >ref|XP_002315463.1| predicted protein [Populus trichocarpa] Length = 529 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -1 Query: 621 YWLEEDDEQLVSGDAPQPGFNFGGGDLPVPSGGFKF 514 YWLEEDDE L SGD Q GF FGG + VPSGGF F Sbjct: 494 YWLEEDDETLPSGDGAQQGFQFGGNGVQVPSGGFNF 529