BLASTX nr result
ID: Rehmannia22_contig00016638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00016638 (359 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004489047.1| PREDICTED: uncharacterized protein At3g15000... 85 1e-14 ref|XP_004251891.1| PREDICTED: uncharacterized protein At3g15000... 85 1e-14 ref|XP_004248249.1| PREDICTED: uncharacterized protein At3g15000... 85 1e-14 ref|XP_006360053.1| PREDICTED: uncharacterized protein At3g15000... 84 3e-14 ref|XP_006358944.1| PREDICTED: uncharacterized protein At3g15000... 84 3e-14 ref|XP_006358943.1| PREDICTED: uncharacterized protein At3g15000... 84 3e-14 gb|EMS47466.1| hypothetical protein TRIUR3_28031 [Triticum urartu] 84 3e-14 dbj|BAJ90563.1| predicted protein [Hordeum vulgare subsp. vulgare] 84 3e-14 dbj|BAJ93961.1| predicted protein [Hordeum vulgare subsp. vulgare] 84 3e-14 ref|XP_004974019.1| PREDICTED: uncharacterized protein At3g15000... 83 4e-14 gb|EPS74428.1| hypothetical protein M569_00328, partial [Genlise... 82 6e-14 ref|XP_002465768.1| hypothetical protein SORBIDRAFT_01g045460 [S... 82 7e-14 gb|EAZ45317.1| hypothetical protein OsJ_29960 [Oryza sativa Japo... 82 7e-14 ref|NP_001063625.1| Os09g0509000 [Oryza sativa Japonica Group] g... 82 7e-14 gb|EMT29592.1| hypothetical protein F775_32958 [Aegilops tauschii] 82 1e-13 gb|EMS56704.1| hypothetical protein TRIUR3_21760 [Triticum urartu] 82 1e-13 ref|XP_003574838.1| PREDICTED: uncharacterized protein At3g15000... 82 1e-13 dbj|BAJ86595.1| predicted protein [Hordeum vulgare subsp. vulgare] 82 1e-13 gb|ESW21401.1| hypothetical protein PHAVU_005G067700g [Phaseolus... 81 1e-13 ref|XP_003543219.1| PREDICTED: uncharacterized protein At3g15000... 81 1e-13 >ref|XP_004489047.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Cicer arietinum] Length = 409 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEEEARMKIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 129 SEEEARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 170 >ref|XP_004251891.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Solanum lycopersicum] Length = 429 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEEEARMKIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 120 SEEEARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 161 >ref|XP_004248249.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Solanum lycopersicum] Length = 391 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEEEARMKIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 128 SEEEARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 169 >ref|XP_006360053.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Solanum tuberosum] Length = 411 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEEEARMKIYSVSTRHY+ FGALVSEELSYKLKELPKVRWVL Sbjct: 128 SEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELPKVRWVL 169 >ref|XP_006358944.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 378 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEE+ARMKIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 120 SEEDARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 161 >ref|XP_006358943.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like isoform X1 [Solanum tuberosum] Length = 403 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEE+ARMKIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 120 SEEDARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 161 >gb|EMS47466.1| hypothetical protein TRIUR3_28031 [Triticum urartu] Length = 312 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SE+EARMKIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 32 SEDEARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 73 >dbj|BAJ90563.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 415 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SE+EARMKIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 123 SEDEARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 164 >dbj|BAJ93961.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 415 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SE+EARMKIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 123 SEDEARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 164 >ref|XP_004974019.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Setaria italica] Length = 403 Score = 82.8 bits (203), Expect = 4e-14 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEEEAR KIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 131 SEEEARQKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 172 >gb|EPS74428.1| hypothetical protein M569_00328, partial [Genlisea aurea] Length = 363 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEEEARMKIYSVSTRHYF FGALVSE+LSYKLKELP+VRWVL Sbjct: 93 SEEEARMKIYSVSTRHYFAFGALVSEDLSYKLKELPRVRWVL 134 >ref|XP_002465768.1| hypothetical protein SORBIDRAFT_01g045460 [Sorghum bicolor] gi|241919622|gb|EER92766.1| hypothetical protein SORBIDRAFT_01g045460 [Sorghum bicolor] Length = 388 Score = 82.0 bits (201), Expect = 7e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEEEAR KIYSVSTRHYF FGALVSEELSYKLKE+PKVRWVL Sbjct: 123 SEEEARQKIYSVSTRHYFAFGALVSEELSYKLKEMPKVRWVL 164 >gb|EAZ45317.1| hypothetical protein OsJ_29960 [Oryza sativa Japonica Group] Length = 396 Score = 82.0 bits (201), Expect = 7e-14 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEEEAR KIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 124 SEEEARHKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 165 >ref|NP_001063625.1| Os09g0509000 [Oryza sativa Japonica Group] gi|113631858|dbj|BAF25539.1| Os09g0509000 [Oryza sativa Japonica Group] gi|215741007|dbj|BAG97502.1| unnamed protein product [Oryza sativa Japonica Group] Length = 396 Score = 82.0 bits (201), Expect = 7e-14 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEEEAR KIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 124 SEEEARHKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 165 >gb|EMT29592.1| hypothetical protein F775_32958 [Aegilops tauschii] Length = 340 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SE+EAR KIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 32 SEQEARQKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 73 >gb|EMS56704.1| hypothetical protein TRIUR3_21760 [Triticum urartu] Length = 648 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SE+EAR KIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 123 SEQEARQKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 164 >ref|XP_003574838.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Brachypodium distachyon] Length = 419 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEEEA+ KIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 127 SEEEAKQKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 168 >dbj|BAJ86595.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 416 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SE+EAR KIYSVSTRHYF FGALVSEELSYKLKELPKVRWVL Sbjct: 123 SEQEARQKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL 164 >gb|ESW21401.1| hypothetical protein PHAVU_005G067700g [Phaseolus vulgaris] Length = 405 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEEEARMKIYSVSTRHYF FGALVSEELSYK+KELP VRWVL Sbjct: 128 SEEEARMKIYSVSTRHYFAFGALVSEELSYKIKELPGVRWVL 169 >ref|XP_003543219.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Glycine max] Length = 401 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 232 SEEEARMKIYSVSTRHYFVFGALVSEELSYKLKELPKVRWVL 357 SEEEARMKIYSVSTRHYF FGALVSEELSYK+KELP VRWVL Sbjct: 127 SEEEARMKIYSVSTRHYFAFGALVSEELSYKIKELPGVRWVL 168