BLASTX nr result
ID: Rehmannia22_contig00016473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00016473 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74439.1| hypothetical protein M569_00315, partial [Genlise... 56 4e-06 >gb|EPS74439.1| hypothetical protein M569_00315, partial [Genlisea aurea] Length = 1027 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = +3 Query: 168 MGPARKSKSLNKRYSYTHDVSPSKDGDGXXXXXXXXXXLSDMLGPRW 308 MGP RKS+++NKRYSY ++VSP +D D L+DMLGPRW Sbjct: 1 MGPPRKSRNVNKRYSYINEVSPKRDEDVTKRSSSRKRKLADMLGPRW 47