BLASTX nr result
ID: Rehmannia22_contig00015287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00015287 (529 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX96527.1| Uncharacterized protein TCM_005763 [Theobroma cacao] 59 7e-07 gb|EOY18324.1| Uncharacterized protein TCM_042921 [Theobroma cacao] 56 4e-06 >gb|EOX96527.1| Uncharacterized protein TCM_005763 [Theobroma cacao] Length = 612 Score = 58.9 bits (141), Expect = 7e-07 Identities = 43/119 (36%), Positives = 65/119 (54%), Gaps = 7/119 (5%) Frame = +2 Query: 2 KMDELRNNFTERIFRESPEDSLRVAKLLMAYFLLFGWNGGKTVIETWAWTLIEDTDQWES 181 K+ L + F E F+ P D+ ++A +L+A +LFG + + V W +L+ED D W Sbjct: 49 KLQALLDTFREGNFQR-PGDATKMALILIANNILFGQDYCRWVTP-WLLSLVEDIDAWNV 106 Query: 182 FIWGKYSYQILLHYLQRLPSELPHVELSV-------YHFYRFMWIFLAYEAIPSLGMFV 337 F+WG Y +++ L YL + E+P +LSV Y+ Y F W F A EAI +L V Sbjct: 107 FLWGHYVWKLTLDYLLK-GFEVP--DLSVIKETRLHYNIYGFTW-FWAMEAISALQKIV 161 >gb|EOY18324.1| Uncharacterized protein TCM_042921 [Theobroma cacao] Length = 715 Score = 56.2 bits (134), Expect = 4e-06 Identities = 37/119 (31%), Positives = 62/119 (52%), Gaps = 7/119 (5%) Frame = +2 Query: 2 KMDELRNNFTERIFRESPEDSLRVAKLLMAYFLLFGWNGGKTVIETWAWTLIEDTDQWES 181 K+ L + F F+ P D+ ++A +L+A +LFG + + W +L+ED D W Sbjct: 59 KLQALLDTFRRSNFKR-PRDATKMAFVLIANNILFG-QYYRIRVTPWLLSLVEDIDAWNV 116 Query: 182 FIWGKYSYQILLHYLQRLPSELPHVELSV-----YHFYRFMWI--FLAYEAIPSLGMFV 337 F WG Y +++ L YL + ++P + ++ Y+ Y F W+ F A EAIP+ V Sbjct: 117 FPWGHYVWKLTLDYLLK-GFKVPDLSVTKETRLHYNIYGFAWVIQFWAMEAIPAFQKIV 174