BLASTX nr result
ID: Rehmannia22_contig00015098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00015098 (352 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63781.1| hypothetical protein M569_11002, partial [Genlise... 61 1e-07 gb|EPS65159.1| hypothetical protein M569_09619, partial [Genlise... 57 2e-06 >gb|EPS63781.1| hypothetical protein M569_11002, partial [Genlisea aurea] Length = 357 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 225 MNSASTQFVPARRMGLYEPIHQMDMWGDFKGKNCLDESPPLI 350 MNS STQFVP+RRMGL +PIHQ+ MW DFK + LD P +I Sbjct: 1 MNSGSTQFVPSRRMGLCDPIHQIAMWDDFKNSSYLDSPPQII 42 >gb|EPS65159.1| hypothetical protein M569_09619, partial [Genlisea aurea] Length = 358 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +3 Query: 237 STQFVPARRMGLYEPIHQMDMWGDFKGKNCLDESPPLI 350 +TQFVP+RRMGL +PIHQ+ MW DFKG + LD SP ++ Sbjct: 1 NTQFVPSRRMGLCDPIHQIVMWDDFKGSDYLDSSPAMM 38