BLASTX nr result
ID: Rehmannia22_contig00014987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00014987 (447 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68471.1| hypothetical protein M569_06301 [Genlisea aurea] 60 4e-07 >gb|EPS68471.1| hypothetical protein M569_06301 [Genlisea aurea] Length = 327 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/73 (39%), Positives = 47/73 (64%) Frame = +2 Query: 8 MVNNQTGDCAIQIAKEQVNADIVLDNQMDDFGTLEELKVDNEFSIHDYSEVLDSCFVMDM 187 +V Q DC +I E+ + + D QMD+FG EL VD++ IHD+SEVL++C +DM Sbjct: 74 VVKTQKVDCVSEIVHEKESGNACSDMQMDEFGNCGELPVDDDLFIHDFSEVLNTCMSVDM 133 Query: 188 VIESSKTVEDSQE 226 +S+++ED ++ Sbjct: 134 ---TSESLEDGEK 143