BLASTX nr result
ID: Rehmannia22_contig00014936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00014936 (970 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509829.1| conserved hypothetical protein [Ricinus comm... 75 4e-11 >ref|XP_002509829.1| conserved hypothetical protein [Ricinus communis] gi|223549728|gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 75.1 bits (183), Expect = 4e-11 Identities = 30/81 (37%), Positives = 53/81 (65%) Frame = -1 Query: 946 PPITSNFVPKECRKIIRDMIRFVIFLHTQKKSLGGLSLDNLVVKGDLLKFWKIKFVKAND 767 P T+N+VP E RK+I+ M+ FV+ +H S G + N+V+K +++KFWK++F+ A+ Sbjct: 106 PSHTANYVPNEYRKLIKSMVTFVVDIHDAGYSTAGFGMPNIVIKNEVVKFWKVQFITASM 165 Query: 766 DTKRNDFSLVASILRKLYEGQ 704 +K NDF + ++ L+ G+ Sbjct: 166 GSKNNDFICLHRVVESLFSGE 186