BLASTX nr result
ID: Rehmannia22_contig00014619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00014619 (745 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC22521.1| hypothetical protein L484_003071 [Morus notabilis] 70 6e-10 ref|XP_004133836.1| PREDICTED: arabinogalactan peptide 20-like [... 70 1e-09 gb|EOX95786.1| Arabinogalactan protein 20 [Theobroma cacao] 69 2e-09 ref|XP_004306698.1| PREDICTED: arabinogalactan peptide 16-like [... 69 2e-09 ref|XP_002320846.1| arabinogalactan-protein [Populus trichocarpa... 68 3e-09 ref|XP_002280494.1| PREDICTED: arabinogalactan peptide 20 [Vitis... 68 4e-09 ref|XP_004248073.1| PREDICTED: arabinogalactan peptide 20-like [... 66 1e-08 gb|AAM12785.1| unknown [Capsicum annuum] 65 2e-08 ref|XP_006358644.1| PREDICTED: arabinogalactan peptide 20-like [... 64 5e-08 gb|EMJ19853.1| hypothetical protein PRUPE_ppa014010mg [Prunus pe... 63 9e-08 ref|XP_006444888.1| hypothetical protein CICLE_v10023364mg [Citr... 63 1e-07 ref|XP_006397819.1| hypothetical protein EUTSA_v10001752mg, part... 63 1e-07 ref|XP_006295364.1| hypothetical protein CARUB_v10024456mg [Caps... 63 1e-07 ref|NP_566070.3| arabinogalactan protein 16 [Arabidopsis thalian... 63 1e-07 ref|XP_003521798.1| PREDICTED: arabinogalactan peptide 20-like [... 63 1e-07 ref|XP_006647136.1| PREDICTED: arabinogalactan peptide 16-like [... 62 2e-07 ref|XP_004969359.1| PREDICTED: arabinogalactan peptide 16-like [... 62 2e-07 ref|XP_002456076.1| hypothetical protein SORBIDRAFT_03g029960 [S... 62 2e-07 ref|NP_001148394.1| AGP16 precursor [Zea mays] gi|195618932|gb|A... 62 2e-07 ref|NP_191723.1| arabinogalactan protein 20 [Arabidopsis thalian... 62 2e-07 >gb|EXC22521.1| hypothetical protein L484_003071 [Morus notabilis] Length = 76 Score = 70.5 bits (171), Expect = 6e-10 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 330 DGTS+DQG+AY+LMLVALVLTYLIHP+DASSYNFF Sbjct: 42 DGTSIDQGVAYVLMLVALVLTYLIHPLDASSYNFF 76 >ref|XP_004133836.1| PREDICTED: arabinogalactan peptide 20-like [Cucumis sativus] gi|449477891|ref|XP_004155154.1| PREDICTED: arabinogalactan peptide 20-like [Cucumis sativus] Length = 78 Score = 69.7 bits (169), Expect = 1e-09 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 330 DGTS+DQGIAY+LML+ALVLTYLIHP+DASSYNFF Sbjct: 42 DGTSIDQGIAYVLMLLALVLTYLIHPLDASSYNFF 76 >gb|EOX95786.1| Arabinogalactan protein 20 [Theobroma cacao] Length = 75 Score = 68.9 bits (167), Expect = 2e-09 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 330 DGTS+DQGIAY+LMLVALVLTYLIHP+DASSY+FF Sbjct: 41 DGTSIDQGIAYVLMLVALVLTYLIHPLDASSYSFF 75 >ref|XP_004306698.1| PREDICTED: arabinogalactan peptide 16-like [Fragaria vesca subsp. vesca] Length = 85 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 330 DG S+DQGIAY+LMLVALVLTYLIHP+DASSYNFF Sbjct: 51 DGISIDQGIAYVLMLVALVLTYLIHPLDASSYNFF 85 >ref|XP_002320846.1| arabinogalactan-protein [Populus trichocarpa] gi|118483747|gb|ABK93766.1| unknown [Populus trichocarpa] gi|222861619|gb|EEE99161.1| arabinogalactan-protein [Populus trichocarpa] Length = 76 Score = 68.2 bits (165), Expect = 3e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 330 DGTS+DQGIAY+LMLVALVLTYLIHP+DASSY FF Sbjct: 42 DGTSIDQGIAYLLMLVALVLTYLIHPLDASSYTFF 76 >ref|XP_002280494.1| PREDICTED: arabinogalactan peptide 20 [Vitis vinifera] gi|147812721|emb|CAN61749.1| hypothetical protein VITISV_014579 [Vitis vinifera] gi|297745395|emb|CBI40475.3| unnamed protein product [Vitis vinifera] Length = 75 Score = 67.8 bits (164), Expect = 4e-09 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 330 DGT++DQGIAY+LMLVALVLTYLIHP+DASSY+FF Sbjct: 41 DGTAIDQGIAYVLMLVALVLTYLIHPLDASSYSFF 75 >ref|XP_004248073.1| PREDICTED: arabinogalactan peptide 20-like [Solanum lycopersicum] Length = 72 Score = 66.2 bits (160), Expect = 1e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 330 DGT++DQGIAY+LML+ALVLTYLIHPMDAS+Y FF Sbjct: 38 DGTTIDQGIAYVLMLLALVLTYLIHPMDASAYTFF 72 >gb|AAM12785.1| unknown [Capsicum annuum] Length = 67 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 330 DG S+DQGIAY+LMLVALVLTYLIHPMDASSY F Sbjct: 33 DGISIDQGIAYVLMLVALVLTYLIHPMDASSYKLF 67 >ref|XP_006358644.1| PREDICTED: arabinogalactan peptide 20-like [Solanum tuberosum] Length = 71 Score = 63.9 bits (154), Expect = 5e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNF 327 DGT++DQGIAY+LML+ALVLTYLIHPMDAS+Y F Sbjct: 38 DGTTIDQGIAYVLMLLALVLTYLIHPMDASAYTF 71 >gb|EMJ19853.1| hypothetical protein PRUPE_ppa014010mg [Prunus persica] Length = 91 Score = 63.2 bits (152), Expect = 9e-08 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 1/36 (2%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDA-SSYNFF 330 DGTS+DQGIAY+LMLVALVLTYLIHP+DA SSY FF Sbjct: 56 DGTSIDQGIAYVLMLVALVLTYLIHPLDASSSYAFF 91 >ref|XP_006444888.1| hypothetical protein CICLE_v10023364mg [Citrus clementina] gi|568876328|ref|XP_006491233.1| PREDICTED: arabinogalactan peptide 20-like [Citrus sinensis] gi|557547150|gb|ESR58128.1| hypothetical protein CICLE_v10023364mg [Citrus clementina] Length = 78 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 1/36 (2%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDA-SSYNFF 330 DGTS+DQGIAY+LMLVAL+LTYLIHP+DA SSY+FF Sbjct: 43 DGTSIDQGIAYLLMLVALLLTYLIHPLDASSSYSFF 78 >ref|XP_006397819.1| hypothetical protein EUTSA_v10001752mg, partial [Eutrema salsugineum] gi|557098892|gb|ESQ39272.1| hypothetical protein EUTSA_v10001752mg, partial [Eutrema salsugineum] Length = 110 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 1/36 (2%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDA-SSYNFF 330 DGTS+DQGIAY+LM+VALVLTYLIHP+DA SSY+FF Sbjct: 75 DGTSIDQGIAYLLMVVALVLTYLIHPLDASSSYSFF 110 >ref|XP_006295364.1| hypothetical protein CARUB_v10024456mg [Capsella rubella] gi|482564072|gb|EOA28262.1| hypothetical protein CARUB_v10024456mg [Capsella rubella] Length = 73 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 1/36 (2%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDA-SSYNFF 330 DGTS+DQGIAY+LM+VALVLTYLIHP+DA SSY+FF Sbjct: 38 DGTSIDQGIAYLLMVVALVLTYLIHPLDASSSYSFF 73 >ref|NP_566070.3| arabinogalactan protein 16 [Arabidopsis thaliana] gi|297828351|ref|XP_002882058.1| hypothetical protein ARALYDRAFT_483786 [Arabidopsis lyrata subsp. lyrata] gi|75100629|sp|O82337.1|AGP16_ARATH RecName: Full=Arabinogalactan peptide 16; Short=AG-peptide 16; Flags: Precursor gi|10880509|gb|AAG24284.1|AF195897_1 arabinogalactan protein [Arabidopsis thaliana] gi|15294170|gb|AAK95262.1|AF410276_1 At2g46330/F11C10.2 [Arabidopsis thaliana] gi|4559376|gb|AAD23036.1| expressed protein [Arabidopsis thaliana] gi|20197373|gb|AAM15047.1| expressed protein [Arabidopsis thaliana] gi|20453295|gb|AAM19886.1| At2g46330/F11C10.2 [Arabidopsis thaliana] gi|21553759|gb|AAM62852.1| unknown [Arabidopsis thaliana] gi|297327897|gb|EFH58317.1| hypothetical protein ARALYDRAFT_483786 [Arabidopsis lyrata subsp. lyrata] gi|330255586|gb|AEC10680.1| arabinogalactan protein 16 [Arabidopsis thaliana] Length = 73 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 1/36 (2%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDA-SSYNFF 330 DGTS+DQGIAY+LM+VALVLTYLIHP+DA SSY+FF Sbjct: 38 DGTSIDQGIAYLLMVVALVLTYLIHPLDASSSYSFF 73 >ref|XP_003521798.1| PREDICTED: arabinogalactan peptide 20-like [Glycine max] Length = 75 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNF 327 DGTS+DQGIAY+LM+VALVLTYLIHP DASS++F Sbjct: 42 DGTSIDQGIAYVLMVVALVLTYLIHPFDASSHHF 75 >ref|XP_006647136.1| PREDICTED: arabinogalactan peptide 16-like [Oryza brachyantha] Length = 74 Score = 62.4 bits (150), Expect = 2e-07 Identities = 32/36 (88%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASS-YNFF 330 DGTSVDQGIAYILMLVALVLTYLIHP+DASS Y F Sbjct: 39 DGTSVDQGIAYILMLVALVLTYLIHPLDASSPYRLF 74 >ref|XP_004969359.1| PREDICTED: arabinogalactan peptide 16-like [Setaria italica] Length = 70 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/36 (86%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASS-YNFF 330 DGTSVDQGIAY+LMLVALVLTYLIHP+DASS Y F Sbjct: 35 DGTSVDQGIAYVLMLVALVLTYLIHPLDASSAYKLF 70 >ref|XP_002456076.1| hypothetical protein SORBIDRAFT_03g029960 [Sorghum bicolor] gi|241928051|gb|EES01196.1| hypothetical protein SORBIDRAFT_03g029960 [Sorghum bicolor] Length = 74 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/36 (86%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASS-YNFF 330 DGTSVDQGIAY+LMLVALVLTYLIHP+DASS Y F Sbjct: 39 DGTSVDQGIAYVLMLVALVLTYLIHPLDASSAYKLF 74 >ref|NP_001148394.1| AGP16 precursor [Zea mays] gi|195618932|gb|ACG31296.1| AGP16 [Zea mays] Length = 71 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/36 (86%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDASS-YNFF 330 DGTSVDQGIAY+LMLVALVLTYLIHP+DASS Y F Sbjct: 36 DGTSVDQGIAYVLMLVALVLTYLIHPLDASSAYKLF 71 >ref|NP_191723.1| arabinogalactan protein 20 [Arabidopsis thaliana] gi|75183616|sp|Q9M373.1|AGP20_ARATH RecName: Full=Arabinogalactan peptide 20; Short=AG-peptide 20; Flags: Precursor gi|6850855|emb|CAB71094.1| putative protein [Arabidopsis thaliana] gi|21536871|gb|AAM61203.1| unknown [Arabidopsis thaliana] gi|98960995|gb|ABF58981.1| At3g61640 [Arabidopsis thaliana] gi|332646714|gb|AEE80235.1| arabinogalactan protein 20 [Arabidopsis thaliana] Length = 74 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/37 (81%), Positives = 34/37 (91%), Gaps = 2/37 (5%) Frame = +1 Query: 226 DGTSVDQGIAYILMLVALVLTYLIHPMDA--SSYNFF 330 DGTS+DQGIAY+LM+VALVLTYLIHP+DA SSY FF Sbjct: 38 DGTSIDQGIAYLLMVVALVLTYLIHPLDASSSSYTFF 74