BLASTX nr result
ID: Rehmannia22_contig00014580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00014580 (367 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT03974.1| Thioredoxin reductase [Aegilops tauschii] 62 1e-07 emb|CAD42635.1| putative thioredoxin reductase [Hordeum vulgare ... 62 1e-07 ref|XP_003562531.1| PREDICTED: thioredoxin reductase NTRC-like [... 62 1e-07 dbj|BAJ91567.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 1e-07 dbj|BAJ89765.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 1e-07 gb|ABY61747.1| NADP-thioredoxin reductase C precursor [Hordeum v... 62 1e-07 ref|XP_006411431.1| hypothetical protein EUTSA_v10016520mg [Eutr... 61 1e-07 ref|XP_006293996.1| hypothetical protein CARUB_v10022987mg [Caps... 61 1e-07 ref|XP_002881790.1| predicted protein [Arabidopsis lyrata subsp.... 61 1e-07 dbj|BAF01794.1| thioredoxin reductase like protein [Arabidopsis ... 61 1e-07 ref|NP_565954.1| NADPH-dependent thioredoxin reductase C [Arabid... 61 1e-07 gb|AAL08250.1| At2g41680/T32G6.20 [Arabidopsis thaliana] gi|2330... 61 1e-07 gb|AAL32557.1| putative thioredoxin reductase [Arabidopsis thali... 61 1e-07 ref|XP_006837423.1| hypothetical protein AMTR_s00107p00020160 [A... 61 2e-07 ref|XP_006658913.1| PREDICTED: thioredoxin reductase NTRC-like [... 60 4e-07 ref|XP_006351311.1| PREDICTED: NADPH-dependent thioredoxin reduc... 60 4e-07 ref|XP_004249260.1| PREDICTED: NADPH-dependent thioredoxin reduc... 60 4e-07 ref|XP_004249259.1| PREDICTED: NADPH-dependent thioredoxin reduc... 60 4e-07 sp|Q70G58.2|NTRC_ORYSJ RecName: Full=Thioredoxin reductase NTRC;... 60 4e-07 gb|EEC82606.1| hypothetical protein OsI_27178 [Oryza sativa Indi... 60 4e-07 >gb|EMT03974.1| Thioredoxin reductase [Aegilops tauschii] Length = 498 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEM+RTFSGVKMKKEYREFIE+NK Sbjct: 469 VQFFKNKEMIRTFSGVKMKKEYREFIESNK 498 >emb|CAD42635.1| putative thioredoxin reductase [Hordeum vulgare subsp. vulgare] Length = 135 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEM+RTFSGVKMKKEYREFIE+NK Sbjct: 106 VQFFKNKEMIRTFSGVKMKKEYREFIESNK 135 >ref|XP_003562531.1| PREDICTED: thioredoxin reductase NTRC-like [Brachypodium distachyon] Length = 523 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEM+RTFSGVKMKKEYREFIE+NK Sbjct: 494 VQFFKNKEMIRTFSGVKMKKEYREFIESNK 523 >dbj|BAJ91567.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 316 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEM+RTFSGVKMKKEYREFIE+NK Sbjct: 287 VQFFKNKEMIRTFSGVKMKKEYREFIESNK 316 >dbj|BAJ89765.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 517 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEM+RTFSGVKMKKEYREFIE+NK Sbjct: 488 VQFFKNKEMIRTFSGVKMKKEYREFIESNK 517 >gb|ABY61747.1| NADP-thioredoxin reductase C precursor [Hordeum vulgare] Length = 474 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEM+RTFSGVKMKKEYREFIE+NK Sbjct: 445 VQFFKNKEMIRTFSGVKMKKEYREFIESNK 474 >ref|XP_006411431.1| hypothetical protein EUTSA_v10016520mg [Eutrema salsugineum] gi|557112600|gb|ESQ52884.1| hypothetical protein EUTSA_v10016520mg [Eutrema salsugineum] Length = 521 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMKKEYREFIEANK Sbjct: 492 VQFFKNKEMLRTISGVKMKKEYREFIEANK 521 >ref|XP_006293996.1| hypothetical protein CARUB_v10022987mg [Capsella rubella] gi|482562704|gb|EOA26894.1| hypothetical protein CARUB_v10022987mg [Capsella rubella] Length = 528 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMKKEYREFIEANK Sbjct: 499 VQFFKNKEMLRTISGVKMKKEYREFIEANK 528 >ref|XP_002881790.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297327629|gb|EFH58049.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 531 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMKKEYREFIEANK Sbjct: 502 VQFFKNKEMLRTISGVKMKKEYREFIEANK 531 >dbj|BAF01794.1| thioredoxin reductase like protein [Arabidopsis thaliana] Length = 267 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMKKEYREFIEANK Sbjct: 238 VQFFKNKEMLRTISGVKMKKEYREFIEANK 267 >ref|NP_565954.1| NADPH-dependent thioredoxin reductase C [Arabidopsis thaliana] gi|75097382|sp|O22229.2|TRXB3_ARATH RecName: Full=NADPH-dependent thioredoxin reductase 3; Short=NTR3; AltName: Full=NADPH-dependent thioredoxin reductase C; Short=ANTR-C; Short=AtNTRC; Flags: Precursor gi|20196949|gb|AAB84351.2| putative thioredoxin reductase [Arabidopsis thaliana] gi|330254921|gb|AEC10015.1| NADPH-dependent thioredoxin reductase C [Arabidopsis thaliana] Length = 529 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMKKEYREFIEANK Sbjct: 500 VQFFKNKEMLRTISGVKMKKEYREFIEANK 529 >gb|AAL08250.1| At2g41680/T32G6.20 [Arabidopsis thaliana] gi|23308231|gb|AAN18085.1| At2g41680/T32G6.20 [Arabidopsis thaliana] Length = 529 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMKKEYREFIEANK Sbjct: 500 VQFFKNKEMLRTISGVKMKKEYREFIEANK 529 >gb|AAL32557.1| putative thioredoxin reductase [Arabidopsis thaliana] gi|20259804|gb|AAM13249.1| putative thioredoxin reductase [Arabidopsis thaliana] Length = 231 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMKKEYREFIEANK Sbjct: 202 VQFFKNKEMLRTISGVKMKKEYREFIEANK 231 >ref|XP_006837423.1| hypothetical protein AMTR_s00107p00020160 [Amborella trichopoda] gi|548840064|gb|ERN00277.1| hypothetical protein AMTR_s00107p00020160 [Amborella trichopoda] Length = 564 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMKKEYREFIEANK Sbjct: 535 VQFFKNKEMLRTVSGVKMKKEYREFIEANK 564 >ref|XP_006658913.1| PREDICTED: thioredoxin reductase NTRC-like [Oryza brachyantha] Length = 517 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMKKEYREFIE+NK Sbjct: 488 VQFFKNKEMLRTVSGVKMKKEYREFIESNK 517 >ref|XP_006351311.1| PREDICTED: NADPH-dependent thioredoxin reductase 3-like [Solanum tuberosum] Length = 543 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMK+EYREFIEANK Sbjct: 514 VQFFKNKEMLRTVSGVKMKREYREFIEANK 543 >ref|XP_004249260.1| PREDICTED: NADPH-dependent thioredoxin reductase 3-like isoform 2 [Solanum lycopersicum] Length = 533 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMK+EYREFIEANK Sbjct: 504 VQFFKNKEMLRTVSGVKMKREYREFIEANK 533 >ref|XP_004249259.1| PREDICTED: NADPH-dependent thioredoxin reductase 3-like isoform 1 [Solanum lycopersicum] Length = 543 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMK+EYREFIEANK Sbjct: 514 VQFFKNKEMLRTVSGVKMKREYREFIEANK 543 >sp|Q70G58.2|NTRC_ORYSJ RecName: Full=Thioredoxin reductase NTRC; AltName: Full=NADPH-dependent thioredoxin reductase C; Short=OsNTRC; Flags: Precursor gi|222637606|gb|EEE67738.1| hypothetical protein OsJ_25429 [Oryza sativa Japonica Group] Length = 515 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMKKEYREFIE+NK Sbjct: 486 VQFFKNKEMLRTVSGVKMKKEYREFIESNK 515 >gb|EEC82606.1| hypothetical protein OsI_27178 [Oryza sativa Indica Group] Length = 514 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 VQFFKNKEMLRTFSGVKMKKEYREFIEANK 92 VQFFKNKEMLRT SGVKMKKEYREFIE+NK Sbjct: 485 VQFFKNKEMLRTVSGVKMKKEYREFIESNK 514