BLASTX nr result
ID: Rehmannia22_contig00014224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00014224 (373 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA11674.1| unnamed protein product [Nicotiana tabacum] 60 2e-07 >dbj|BAA11674.1| unnamed protein product [Nicotiana tabacum] Length = 1338 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +1 Query: 1 TDENGADMLTKSLPRDKFEACRSKAGLVDFPHKVEGENC 117 TDENG+DMLTK+LP+ KFE CR AG+VD P+ +GENC Sbjct: 1300 TDENGSDMLTKTLPKGKFEFCREAAGIVDPPYSWKGENC 1338