BLASTX nr result
ID: Rehmannia22_contig00013812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00013812 (819 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC33961.1| contains similarity to reverse trancriptase (Pfam... 58 4e-06 emb|CAB40051.1| putative protein [Arabidopsis thaliana] gi|72677... 58 4e-06 >gb|AAC33961.1| contains similarity to reverse trancriptase (Pfam: rvt.hmm, score: 42.57) [Arabidopsis thaliana] Length = 1662 Score = 58.2 bits (139), Expect = 4e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +2 Query: 689 AHLRSVLAKACKDEESFWSQKSRITWLKEGDRNSKIFHACT 811 +H++ L A +DEE +W QKSR W+KEGDRN++ FHACT Sbjct: 701 SHIQRELTVAYRDEERYWQQKSRNQWMKEGDRNTEFFHACT 741 >emb|CAB40051.1| putative protein [Arabidopsis thaliana] gi|7267781|emb|CAB81184.1| putative protein [Arabidopsis thaliana] Length = 1294 Score = 58.2 bits (139), Expect = 4e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +2 Query: 689 AHLRSVLAKACKDEESFWSQKSRITWLKEGDRNSKIFHACT 811 +H++ L A +DEE +W QKSR W+KEGDRN++ FHACT Sbjct: 681 SHIQRELTVAYRDEERYWQQKSRNQWMKEGDRNTEFFHACT 721