BLASTX nr result
ID: Rehmannia22_contig00013747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00013747 (304 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22230.3| unnamed protein product [Vitis vinifera] 72 8e-11 ref|XP_002278470.1| PREDICTED: granule-bound starch synthase 2, ... 72 8e-11 gb|ESW23227.1| hypothetical protein PHAVU_004G029100g [Phaseolus... 71 2e-10 ref|XP_006827270.1| hypothetical protein AMTR_s00010p00263000 [A... 71 2e-10 ref|XP_004304294.1| PREDICTED: starch synthase 2, chloroplastic/... 71 2e-10 dbj|BAD18847.1| starch synthase II-2 precursor [Phaseolus vulgaris] 71 2e-10 gb|ACL98482.1| starch synthase IIb precursor [Lotus japonicus] 70 4e-10 gb|AAY89383.1| starch synthase isoform 2 [Nicotiana langsdorffii... 70 4e-10 gb|ACL98483.1| starch synthase IIa precursor [Vigna unguiculata] 69 5e-10 ref|NP_001235811.1| starch synthase IIa-2 [Glycine max] gi|22106... 69 5e-10 ref|NP_001235796.1| starch synthase IIa-1 [Glycine max] gi|22106... 69 5e-10 gb|EMJ16167.1| hypothetical protein PRUPE_ppa001734mg [Prunus pe... 69 6e-10 ref|XP_003573954.1| PREDICTED: soluble starch synthase 2-1, chlo... 69 6e-10 ref|XP_006482606.1| PREDICTED: granule-bound starch synthase 2, ... 69 8e-10 ref|XP_006431165.1| hypothetical protein CICLE_v10011124mg [Citr... 69 8e-10 gb|AAC19119.1| starch synthase [Ipomoea batatas] 69 8e-10 ref|XP_002531856.1| starch synthase, putative [Ricinus communis]... 69 8e-10 ref|XP_006408470.1| hypothetical protein EUTSA_v10020091mg [Eutr... 68 1e-09 gb|EPS68296.1| hypothetical protein M569_06471, partial [Genlise... 68 1e-09 ref|XP_004983043.1| PREDICTED: soluble starch synthase 2-1, chlo... 68 1e-09 >emb|CBI22230.3| unnamed protein product [Vitis vinifera] Length = 788 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGMMQDLSWD+AAQNYEEVLVAAKYQW Sbjct: 756 WEGLQRRGMMQDLSWDHAAQNYEEVLVAAKYQW 788 >ref|XP_002278470.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like [Vitis vinifera] Length = 772 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGMMQDLSWD+AAQNYEEVLVAAKYQW Sbjct: 740 WEGLQRRGMMQDLSWDHAAQNYEEVLVAAKYQW 772 >gb|ESW23227.1| hypothetical protein PHAVU_004G029100g [Phaseolus vulgaris] Length = 757 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+G+QRRGMMQDLSWDNAAQ YEEVLVAAKYQW Sbjct: 725 WEGIQRRGMMQDLSWDNAAQQYEEVLVAAKYQW 757 >ref|XP_006827270.1| hypothetical protein AMTR_s00010p00263000 [Amborella trichopoda] gi|548831699|gb|ERM94507.1| hypothetical protein AMTR_s00010p00263000 [Amborella trichopoda] Length = 763 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+G+QRRGMMQDLSWDNAAQ YEEVLVAAKYQW Sbjct: 731 WEGIQRRGMMQDLSWDNAAQQYEEVLVAAKYQW 763 >ref|XP_004304294.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic-like [Fragaria vesca subsp. vesca] Length = 759 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+G+QRRGMMQDLSWD AAQNYEEVLVAAKYQW Sbjct: 727 WEGIQRRGMMQDLSWDKAAQNYEEVLVAAKYQW 759 >dbj|BAD18847.1| starch synthase II-2 precursor [Phaseolus vulgaris] Length = 738 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+G+QRRGMMQDLSWDNAAQ YEEVLVAAKYQW Sbjct: 706 WEGIQRRGMMQDLSWDNAAQQYEEVLVAAKYQW 738 >gb|ACL98482.1| starch synthase IIb precursor [Lotus japonicus] Length = 800 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+G+QRRGMMQDLSWDNAAQ YEEVLVAAKYQW Sbjct: 768 WEGIQRRGMMQDLSWDNAAQLYEEVLVAAKYQW 800 >gb|AAY89383.1| starch synthase isoform 2 [Nicotiana langsdorffii x Nicotiana sanderae] Length = 207 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGM QDLSWDNAA NYEEVLVAAKYQW Sbjct: 175 WEGLQRRGMTQDLSWDNAAHNYEEVLVAAKYQW 207 >gb|ACL98483.1| starch synthase IIa precursor [Vigna unguiculata] Length = 779 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGMMQDLSWD AAQ YEEVLVAAKYQW Sbjct: 747 WEGLQRRGMMQDLSWDKAAQQYEEVLVAAKYQW 779 >ref|NP_001235811.1| starch synthase IIa-2 [Glycine max] gi|221063672|gb|ACL98480.1| starch synthase IIa-2 precursor [Glycine max] Length = 774 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGM QDLSWDNAAQ YEEVLVAAKYQW Sbjct: 742 WEGLQRRGMTQDLSWDNAAQQYEEVLVAAKYQW 774 >ref|NP_001235796.1| starch synthase IIa-1 [Glycine max] gi|221063670|gb|ACL98479.1| starch synthase IIa-1 precursor [Glycine max] Length = 757 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGM QDLSWDNAAQ YEEVLVAAKYQW Sbjct: 725 WEGLQRRGMTQDLSWDNAAQQYEEVLVAAKYQW 757 >gb|EMJ16167.1| hypothetical protein PRUPE_ppa001734mg [Prunus persica] Length = 773 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+G+QRRGM QDLSWD+AAQNYEEVLVAAKYQW Sbjct: 741 WEGIQRRGMKQDLSWDHAAQNYEEVLVAAKYQW 773 >ref|XP_003573954.1| PREDICTED: soluble starch synthase 2-1, chloroplastic/amyloplastic-like [Brachypodium distachyon] Length = 763 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGMMQDLSWDNAA++YEEVLV AKYQW Sbjct: 731 WEGLQRRGMMQDLSWDNAAKSYEEVLVTAKYQW 763 >ref|XP_006482606.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like [Citrus sinensis] Length = 769 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGMMQDLSWD+AAQ YEEVLVAAKYQW Sbjct: 737 WEGLQRRGMMQDLSWDHAAQLYEEVLVAAKYQW 769 >ref|XP_006431165.1| hypothetical protein CICLE_v10011124mg [Citrus clementina] gi|557533222|gb|ESR44405.1| hypothetical protein CICLE_v10011124mg [Citrus clementina] Length = 769 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGMMQDLSWD+AAQ YEEVLVAAKYQW Sbjct: 737 WEGLQRRGMMQDLSWDHAAQLYEEVLVAAKYQW 769 >gb|AAC19119.1| starch synthase [Ipomoea batatas] Length = 630 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGMMQDLSWD+AA+ YEEVLVAAKYQW Sbjct: 598 WEGLQRRGMMQDLSWDHAAEKYEEVLVAAKYQW 630 >ref|XP_002531856.1| starch synthase, putative [Ricinus communis] gi|223528506|gb|EEF30534.1| starch synthase, putative [Ricinus communis] Length = 754 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGMMQDLSWD+AA+ YEEVLVAAKYQW Sbjct: 722 WEGLQRRGMMQDLSWDHAAEKYEEVLVAAKYQW 754 >ref|XP_006408470.1| hypothetical protein EUTSA_v10020091mg [Eutrema salsugineum] gi|557109616|gb|ESQ49923.1| hypothetical protein EUTSA_v10020091mg [Eutrema salsugineum] Length = 805 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGM QDLSWDNAA+ YEEVLVAAKYQW Sbjct: 773 WEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYQW 805 >gb|EPS68296.1| hypothetical protein M569_06471, partial [Genlisea aurea] Length = 520 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+GLQRRGMMQDLSWDNAA+ YE+VLVAAKYQW Sbjct: 488 WEGLQRRGMMQDLSWDNAAELYEQVLVAAKYQW 520 >ref|XP_004983043.1| PREDICTED: soluble starch synthase 2-1, chloroplastic/amyloplastic-like isoform X2 [Setaria italica] Length = 777 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 303 WDGLQRRGMMQDLSWDNAAQNYEEVLVAAKYQW 205 W+G+QRRGMMQDLSWDNAA+ YEEVLVAAKYQW Sbjct: 745 WEGIQRRGMMQDLSWDNAAKLYEEVLVAAKYQW 777