BLASTX nr result
ID: Rehmannia22_contig00013659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00013659 (608 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67479.1| hypothetical protein VITISV_035454 [Vitis vinifera] 59 8e-07 >emb|CAN67479.1| hypothetical protein VITISV_035454 [Vitis vinifera] Length = 528 Score = 59.3 bits (142), Expect = 8e-07 Identities = 29/64 (45%), Positives = 37/64 (57%) Frame = +3 Query: 351 QAFGFPVGPSFCFAVPHNLHRRYSHLDCRIVVELHMPMLPVCDXXXXXXXXXHQSPHSCH 530 +A G + PS F + +LHRR HLD R+VV++HMP+L V D Q PHSC Sbjct: 438 EALGVSIRPSLRFPLSPHLHRRRRHLDRRVVVDVHMPLLLVRDGTSRACAGADQGPHSCD 497 Query: 531 GVVY 542 GV Y Sbjct: 498 GVGY 501