BLASTX nr result
ID: Rehmannia22_contig00013597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00013597 (462 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309556.2| hypothetical protein POPTR_0006s25770g [Popu... 64 3e-08 ref|XP_002298784.1| predicted protein [Populus trichocarpa] gi|2... 64 3e-08 ref|XP_002324811.2| hypothetical protein POPTR_0018s00620g [Popu... 61 2e-07 ref|XP_004245269.1| PREDICTED: probable ADP-ribosylation factor-... 59 7e-07 ref|XP_004164262.1| PREDICTED: ADP-ribosylation factor-binding p... 59 7e-07 ref|XP_004150282.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 59 7e-07 ref|XP_006366215.1| PREDICTED: TOM1-like protein 2-like [Solanum... 56 4e-06 ref|XP_002516559.1| protein transporter, putative [Ricinus commu... 55 1e-05 >ref|XP_002309556.2| hypothetical protein POPTR_0006s25770g [Populus trichocarpa] gi|550337089|gb|EEE93079.2| hypothetical protein POPTR_0006s25770g [Populus trichocarpa] Length = 650 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 460 SKPEDKLFGDLVDISKFKPGKTTPGRAGSM 371 SKPEDKLFGDLVDISKFKPGK+TPGRAGSM Sbjct: 621 SKPEDKLFGDLVDISKFKPGKSTPGRAGSM 650 >ref|XP_002298784.1| predicted protein [Populus trichocarpa] gi|224092316|ref|XP_002309555.1| predicted protein [Populus trichocarpa] Length = 159 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 460 SKPEDKLFGDLVDISKFKPGKTTPGRAGSM 371 SKPEDKLFGDLVDISKFKPGK+TPGRAGSM Sbjct: 130 SKPEDKLFGDLVDISKFKPGKSTPGRAGSM 159 >ref|XP_002324811.2| hypothetical protein POPTR_0018s00620g [Populus trichocarpa] gi|550317727|gb|EEF03376.2| hypothetical protein POPTR_0018s00620g [Populus trichocarpa] Length = 674 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 460 SKPEDKLFGDLVDISKFKPGKTTPGRAGSM 371 SKPEDKLFGDLVDISKFKPGK+TPGRAG + Sbjct: 645 SKPEDKLFGDLVDISKFKPGKSTPGRAGGL 674 >ref|XP_004245269.1| PREDICTED: probable ADP-ribosylation factor-binding protein C25H2.16c-like [Solanum lycopersicum] Length = 674 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 460 SKPEDKLFGDLVDISKFKPGKTTPGRAGSM 371 SKPEDKLFGDLVDISKFK KTTPGRAGSM Sbjct: 645 SKPEDKLFGDLVDISKFKSPKTTPGRAGSM 674 >ref|XP_004164262.1| PREDICTED: ADP-ribosylation factor-binding protein GGA1-like [Cucumis sativus] Length = 697 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 460 SKPEDKLFGDLVDISKFKPGKTTPGRAGSM 371 +KPEDKLFGDLVDI+KFKP K+TPGRAGSM Sbjct: 668 NKPEDKLFGDLVDIAKFKPAKSTPGRAGSM 697 >ref|XP_004150282.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101204650 [Cucumis sativus] Length = 688 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 460 SKPEDKLFGDLVDISKFKPGKTTPGRAGSM 371 +KPEDKLFGDLVDI+KFKP K+TPGRAGSM Sbjct: 659 NKPEDKLFGDLVDIAKFKPAKSTPGRAGSM 688 >ref|XP_006366215.1| PREDICTED: TOM1-like protein 2-like [Solanum tuberosum] Length = 674 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -3 Query: 460 SKPEDKLFGDLVDISKFKPGKTTPGRAGSM 371 SKPEDKLFGD VDISKFK KTTPGRAGSM Sbjct: 645 SKPEDKLFGDPVDISKFKSPKTTPGRAGSM 674 >ref|XP_002516559.1| protein transporter, putative [Ricinus communis] gi|223544379|gb|EEF45900.1| protein transporter, putative [Ricinus communis] Length = 667 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 460 SKPEDKLFGDLVDISKFKPGKTTPGRAGSM 371 SKPEDKLFGDLVDI+KFKP K+TP +AGSM Sbjct: 638 SKPEDKLFGDLVDIAKFKPTKSTPEKAGSM 667