BLASTX nr result
ID: Rehmannia22_contig00013560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00013560 (475 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71885.1| hypothetical protein M569_02874, partial [Genlise... 55 1e-05 >gb|EPS71885.1| hypothetical protein M569_02874, partial [Genlisea aurea] Length = 328 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +3 Query: 348 IGFLETAYVTTSMAVASGCFLYILSTKFVGETCLYCLASATL 473 +G L +TTSMA AS FLYILST+F GE+CLYCLASA L Sbjct: 126 VGELILIGITTSMAAASTYFLYILSTEFNGESCLYCLASAAL 167