BLASTX nr result
ID: Rehmannia22_contig00013387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00013387 (514 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ01067.1| hypothetical protein PRUPE_ppa006007mg [Prunus pe... 58 1e-06 gb|EPS67823.1| hypothetical protein M569_06951, partial [Genlise... 57 3e-06 ref|XP_002307594.1| transducin family protein [Populus trichocar... 55 7e-06 ref|XP_002524762.1| WD-repeat protein, putative [Ricinus communi... 55 1e-05 >gb|EMJ01067.1| hypothetical protein PRUPE_ppa006007mg [Prunus persica] Length = 432 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 1 TAAEAVKTAMRNLLIKKNYSAERREVRKKGRNDKK 105 TAAEA+KT+M NLLIKK YS E+RE RK+GRNDKK Sbjct: 395 TAAEALKTSMSNLLIKKQYSTEKREFRKRGRNDKK 429 >gb|EPS67823.1| hypothetical protein M569_06951, partial [Genlisea aurea] Length = 201 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 4 AAEAVKTAMRNLLIKKNYSAERREVRKKGRNDKK 105 AAEA K +MRNLLIKK YS+ERRE RK+GRNDKK Sbjct: 168 AAEAAKKSMRNLLIKKRYSSERREERKRGRNDKK 201 >ref|XP_002307594.1| transducin family protein [Populus trichocarpa] gi|222857043|gb|EEE94590.1| transducin family protein [Populus trichocarpa] Length = 440 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 4 AAEAVKTAMRNLLIKKNYSAERREVRKKGRNDKKNQ 111 AAEAVKT+M NLLIKK Y+ E+RE RK+GRNDKK + Sbjct: 404 AAEAVKTSMCNLLIKKQYTTEKREFRKRGRNDKKTK 439 >ref|XP_002524762.1| WD-repeat protein, putative [Ricinus communis] gi|223535946|gb|EEF37605.1| WD-repeat protein, putative [Ricinus communis] Length = 435 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 4 AAEAVKTAMRNLLIKKNYSAERREVRKKGRNDKK 105 AAEAVKTAM NLLIKK Y+ E+RE RK+GRND+K Sbjct: 399 AAEAVKTAMCNLLIKKQYTTEKREFRKRGRNDRK 432