BLASTX nr result
ID: Rehmannia22_contig00013258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00013258 (446 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267616.1| PREDICTED: two-component response regulator ... 55 1e-05 >ref|XP_002267616.1| PREDICTED: two-component response regulator ARR11 [Vitis vinifera] gi|297738324|emb|CBI27525.3| unnamed protein product [Vitis vinifera] Length = 594 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = -3 Query: 222 VESYGYNNHELVADVAPHLFDSLRFDPEYLSDPVEYPVIDQGLFIA 85 +E Y++ +L+ +V HL+D L+ D EYLSD EYP++DQGLFIA Sbjct: 549 IEFSDYHDQKLITEVPFHLYDPLKLDYEYLSDLTEYPIMDQGLFIA 594