BLASTX nr result
ID: Rehmannia22_contig00013031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00013031 (386 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510159.1| conserved hypothetical protein [Ricinus comm... 68 1e-09 gb|AAR26237.1| early dehydration inducible protein [Craterostigm... 64 2e-08 ref|XP_004291066.1| PREDICTED: uncharacterized protein LOC101292... 56 4e-06 >ref|XP_002510159.1| conserved hypothetical protein [Ricinus communis] gi|223550860|gb|EEF52346.1| conserved hypothetical protein [Ricinus communis] Length = 82 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/70 (50%), Positives = 44/70 (62%), Gaps = 5/70 (7%) Frame = -1 Query: 347 QGTERINDEGAVEINVETVDYRTPPGGDKEPHKENVEITHLTRTDESPD-----TGNKVV 183 QGTER+N+EGA+E V+T+DYRTP G D EP KENV + HL R E T V Sbjct: 4 QGTERVNEEGAIETTVDTIDYRTPAGAD-EPRKENVGVVHLKRNKEEDSGVLARTAAAVT 62 Query: 182 DNLRSAKEPI 153 + + SAK+ I Sbjct: 63 NTIESAKDAI 72 >gb|AAR26237.1| early dehydration inducible protein [Craterostigma plantagineum] Length = 91 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/64 (51%), Positives = 40/64 (62%), Gaps = 5/64 (7%) Frame = -1 Query: 338 ERINDEGAVEINVETVDYRTPPGGDKEPHKENVEITHLTRTDES-----PDTGNKVVDNL 174 E I DEGAVE VETV+YR PG +KEP +E VE+THL TDE + KV + + Sbjct: 19 ENITDEGAVEKKVETVNYRHGPGSEKEPAEEKVEVTHLPHTDEEKPGVLKEAAEKVAEKI 78 Query: 173 RSAK 162 SAK Sbjct: 79 ESAK 82 >ref|XP_004291066.1| PREDICTED: uncharacterized protein LOC101292566 [Fragaria vesca subsp. vesca] Length = 105 Score = 56.2 bits (134), Expect = 4e-06 Identities = 31/77 (40%), Positives = 42/77 (54%), Gaps = 13/77 (16%) Frame = -1 Query: 341 TERINDEGAVEINVETVDYRTPPGGDKEPHKENVEITHLTRTDESPDTGNK--------- 189 TE +N++G VE+ V+TVD+R+P G DKEP KE VEI H D+ K Sbjct: 8 TEGVNEQGGVEVKVDTVDFRSPAGDDKEPVKEKVEILH--EIDDGGANSGKTGAAGFVEK 65 Query: 188 ----VVDNLRSAKEPIS 150 V D +SAK+ +S Sbjct: 66 AATAVADTFKSAKDAVS 82