BLASTX nr result
ID: Rehmannia22_contig00012993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00012993 (437 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB32784.1| OsCesA3 protein [Morus notabilis] 80 4e-13 ref|XP_006482874.1| PREDICTED: cellulose synthase A catalytic su... 80 4e-13 gb|EMJ21487.1| hypothetical protein PRUPE_ppa000593mg [Prunus pe... 80 4e-13 gb|AFZ78557.1| cellulose synthase [Populus tomentosa] 80 4e-13 gb|AEE60898.1| cellulose synthase [Populus tomentosa] 80 4e-13 ref|XP_002532166.1| Cellulose synthase A catalytic subunit 6 [UD... 80 4e-13 ref|XP_002314037.1| cellulose synthase family protein [Populus t... 80 4e-13 ref|XP_002298432.1| hypothetical protein POPTR_0001s27320g [Popu... 80 4e-13 ref|XP_003533898.2| PREDICTED: cellulose synthase A catalytic su... 79 5e-13 ref|XP_004162186.1| PREDICTED: cellulose synthase A catalytic su... 79 5e-13 ref|XP_004149389.1| PREDICTED: cellulose synthase A catalytic su... 79 5e-13 gb|AFZ78564.1| cellulose synthase [Populus tomentosa] 79 5e-13 gb|AAD39534.2| cellulose synthase catalytic subunit [Gossypium h... 79 5e-13 gb|AEP33557.1| cellulose synthase catalytic subunit [Gossypium g... 79 5e-13 gb|AEP33556.1| cellulose synthase catalytic subunit [Gossypium a... 79 5e-13 gb|AEP33554.1| cellulose synthase catalytic subunit [Gossypium d... 79 5e-13 gb|AEP33552.1| cellulose synthase catalytic subunit [Gossypium a... 79 5e-13 gb|AEP33551.1| cellulose synthase catalytic subunit [Gossypium h... 79 5e-13 gb|AEP33550.1| truncated cellulose synthase catalytic subunit [G... 79 5e-13 gb|AEP33547.1| cellulose synthase catalytic subunit [Gossypium b... 79 5e-13 >gb|EXB32784.1| OsCesA3 protein [Morus notabilis] Length = 1077 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC Sbjct: 1042 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1077 >ref|XP_006482874.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like isoform X1 [Citrus sinensis] gi|568858679|ref|XP_006482875.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like isoform X2 [Citrus sinensis] gi|568858681|ref|XP_006482876.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like isoform X3 [Citrus sinensis] gi|568858683|ref|XP_006482877.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like isoform X4 [Citrus sinensis] Length = 1079 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC Sbjct: 1044 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1079 >gb|EMJ21487.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica] Length = 1082 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC Sbjct: 1047 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1082 >gb|AFZ78557.1| cellulose synthase [Populus tomentosa] Length = 1079 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC Sbjct: 1044 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1079 >gb|AEE60898.1| cellulose synthase [Populus tomentosa] Length = 1079 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC Sbjct: 1044 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1079 >ref|XP_002532166.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative [Ricinus communis] gi|223528153|gb|EEF30219.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative [Ricinus communis] Length = 1085 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC Sbjct: 1050 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1085 >ref|XP_002314037.1| cellulose synthase family protein [Populus trichocarpa] gi|222850445|gb|EEE87992.1| cellulose synthase family protein [Populus trichocarpa] Length = 1079 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC Sbjct: 1044 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1079 >ref|XP_002298432.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa] gi|566151275|ref|XP_006369625.1| cellulose synthase family protein [Populus trichocarpa] gi|566151277|ref|XP_006369626.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa] gi|222845690|gb|EEE83237.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa] gi|550348304|gb|ERP66194.1| cellulose synthase family protein [Populus trichocarpa] gi|550348305|gb|ERP66195.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa] Length = 1081 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC Sbjct: 1046 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1081 >ref|XP_003533898.2| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like isoform X1 [Glycine max] gi|571477127|ref|XP_006587173.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like isoform X2 [Glycine max] Length = 1074 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVR+DPFTTRVTGPDVEQCGINC Sbjct: 1039 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1074 >ref|XP_004162186.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Cucumis sativus] Length = 1070 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVR+DPFTTRVTGPDVEQCGINC Sbjct: 1035 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1070 >ref|XP_004149389.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Cucumis sativus] Length = 1050 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVR+DPFTTRVTGPDVEQCGINC Sbjct: 1015 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1050 >gb|AFZ78564.1| cellulose synthase [Populus tomentosa] Length = 1061 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWS+LLASIFSLLWVRVDPFTTRVTGPDVEQCGINC Sbjct: 1026 VWSVLLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1061 >gb|AAD39534.2| cellulose synthase catalytic subunit [Gossypium hirsutum] Length = 1067 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVR+DPFTTRVTGPDVEQCGINC Sbjct: 1032 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33557.1| cellulose synthase catalytic subunit [Gossypium gossypioides] Length = 1067 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVR+DPFTTRVTGPDVEQCGINC Sbjct: 1032 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33556.1| cellulose synthase catalytic subunit [Gossypium aridum] gi|347953865|gb|AEP33558.1| cellulose synthase catalytic subunit [Gossypium lobatum] Length = 1067 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVR+DPFTTRVTGPDVEQCGINC Sbjct: 1032 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33554.1| cellulose synthase catalytic subunit [Gossypium davidsonii] gi|347953859|gb|AEP33555.1| cellulose synthase catalytic subunit [Gossypium klotzschianum] Length = 1067 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVR+DPFTTRVTGPDVEQCGINC Sbjct: 1032 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33552.1| cellulose synthase catalytic subunit [Gossypium armourianum] Length = 1067 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVR+DPFTTRVTGPDVEQCGINC Sbjct: 1032 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33551.1| cellulose synthase catalytic subunit [Gossypium hirsutum subsp. latifolium] Length = 1067 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVR+DPFTTRVTGPDVEQCGINC Sbjct: 1032 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33550.1| truncated cellulose synthase catalytic subunit [Gossypium hirsutum subsp. latifolium] Length = 684 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVR+DPFTTRVTGPDVEQCGINC Sbjct: 649 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 684 >gb|AEP33547.1| cellulose synthase catalytic subunit [Gossypium barbadense var. brasiliense] gi|347953847|gb|AEP33549.1| cellulose synthase catalytic subunit [Gossypium barbadense var. peruvianum] Length = 1066 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 435 VWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 328 VWSILLASIFSLLWVR+DPFTTRVTGPDVEQCGINC Sbjct: 1031 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1066